KEGG   Ursus maritimus (polar bear): 103672315
Entry
103672315         CDS       T03271                                 

Gene name
DDB2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr03420  Nucleotide excision repair
umr04115  p53 signaling pathway
umr04120  Ubiquitin mediated proteolysis
umr05161  Hepatitis B
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05216  Thyroid cancer
umr05217  Basal cell carcinoma
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103672315 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    103672315 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    103672315 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103672315 (DDB2)
   05202 Transcriptional misregulation in cancer
    103672315 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103672315 (DDB2)
   05212 Pancreatic cancer
    103672315 (DDB2)
   05225 Hepatocellular carcinoma
    103672315 (DDB2)
   05226 Gastric cancer
    103672315 (DDB2)
   05214 Glioma
    103672315 (DDB2)
   05216 Thyroid cancer
    103672315 (DDB2)
   05220 Chronic myeloid leukemia
    103672315 (DDB2)
   05217 Basal cell carcinoma
    103672315 (DDB2)
   05218 Melanoma
    103672315 (DDB2)
   05213 Endometrial cancer
    103672315 (DDB2)
   05224 Breast cancer
    103672315 (DDB2)
   05222 Small cell lung cancer
    103672315 (DDB2)
   05223 Non-small cell lung cancer
    103672315 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103672315 (DDB2)
   05169 Epstein-Barr virus infection
    103672315 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:umr04121]
    103672315 (DDB2)
   03400 DNA repair and recombination proteins [BR:umr03400]
    103672315 (DDB2)
Ubiquitin system [BR:umr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     103672315 (DDB2)
DNA repair and recombination proteins [BR:umr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      103672315 (DDB2)
SSDB
Motif
Pfam: WD40 EF-hand_1
Other DBs
NCBI-GeneID: 103672315
NCBI-ProteinID: XP_008699227
UniProt: A0A384CWK6
LinkDB
Position
Un
AA seq 416 aa
MAPRKRPETQKTPEVSVRPKSKRSRSPRELEPEAKKLCVKGPGSSRRFDSGCLWAGLASL
QVPPSYSIVRALHQHKLGNAAWPSLQQGLQQAFLHSLASYRIFQKAAPFDRRATSLAWHP
THPSTLAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLDTNQFFTSSMEGTT
RLQDFKGNTLRVFTSSGTCNFWFCSLPAPASLRPTXEGSPSLQLWNLRMHKKKVTHVALN
PCCDWFLATASVDQTVKIWDLRQVRGKSSFLHSLPHSHPVNAACFSPDGAQLLTTDQKSE
LRVYSASQWDCPPSLIPHPHRHFQHLTPIKATWHPRYNLIVVGRYPDPNFKSCTPHELRT
IDVFDGNSGKMMYQLYDPESSGIISLNEFNSMGDTLASVMGYHILIWSQEEAGRRT
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggctcctaggaaacgcccagaaacccagaagacccccgaggtgtctgtgcgccccaag
agcaagaggagcagaagcccccgggagctggagcccgaggccaagaagctctgtgtgaag
ggccccggttctagcagaagatttgactcgggctgcctttgggcggggttggctagcctg
caggtcccgccatcatacagcatcgtcagggccctccaccagcataagctgggcaacgct
gcctggccatcgctgcaacagggtctccagcaggcctttctgcactctctggcttcttac
cggatattccaaaaggctgccccctttgacaggagggccacatccttggcatggcaccca
actcaccccagcaccctggctgtgggttccaaagggggagatatcatgctctggaacttt
ggcataaaggacaaacccaccttcattaaagggattggagctggagggagcatcactggg
ctgaagtttaaccctcttgataccaaccagtttttcacctcctcaatggagggaacaact
aggctgcaagactttaaaggcaacacgctccgagtttttaccagctcaggcacctgcaac
ttctggttttgcagtctccctgccccggcctccctgcgccccaccnntgaagggagccct
tctctgcagctttggaatctgagaatgcacaaaaagaaagtgacccacgtggccttgaac
ccatgctgtgattggttcctggccacagcctccgtagaccaaacagtgaaaatctgggac
ctgcgccaggttagagggaaatccagcttcctccactcgctgccgcatagccatcctgtc
aacgcagcttgttttagtcctgatggagcccagctcctgaccactgaccagaagagtgag
ctccgggtttattcggcctcccagtgggactgccccccgagcctgatcccacaccctcac
cgccacttccagcacctgacgcccatcaaggcaacctggcatcctcggtacaacctcatt
gtcgtgggccggtacccagatcctaatttcaaaagctgtacaccccatgaattaaggacc
attgatgtgtttgatggaaactcagggaagatgatgtatcagctctatgacccagaatct
tctggtatcatttcgctcaatgagttcaattccatgggggacacgctggcctctgtgatg
ggttatcacattctcatttggagccaggaggaagctggaaggcggacatga

DBGET integrated database retrieval system