KEGG   Ursus maritimus (polar bear): 103673220
Entry
103673220         CDS       T03271                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
umr04151  PI3K-Akt signaling pathway
umr04217  Necroptosis
umr04380  Osteoclast differentiation
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103673220 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    103673220 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103673220 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103673220 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103673220 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    103673220 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    103673220 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103673220 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103673220 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103673220 (IFNAR1)
   05160 Hepatitis C
    103673220 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    103673220 (IFNAR1)
   05164 Influenza A
    103673220 (IFNAR1)
   05162 Measles
    103673220 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    103673220 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103673220 (IFNAR1)
   05169 Epstein-Barr virus infection
    103673220 (IFNAR1)
   05165 Human papillomavirus infection
    103673220 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:umr04050]
    103673220 (IFNAR1)
Cytokine receptors [BR:umr04050]
 Interleukin receptor families
  IFN receptor family
   103673220 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 DUF5109 DUF4542
Other DBs
NCBI-GeneID: 103673220
NCBI-ProteinID: XP_008700172
UniProt: A0A384CZA9
LinkDB
Position
Un
AA seq 543 aa
FVVPLFLGGTNLKSPQNVEVYIVDDTFILRWDGSSPSVRNVTFSADYQTLENDTWLKLPG
CQSIANTKCNFSSLKLNIYEEIKLRIRAEKGNNTSPWHYVDSFTLFGKAQIGPPKVHLEA
EDKAIIINITPPGTKGRGMWSLDSSSFTYSLEIWKNSSSGDRRTETVYPRDKIYKLSPET
TYCLKVKARLLPRKIGVFSPVYCIKTTVENKLPPPENIQVDAENRIYVLKWDYAYENVTF
QAQWLHAYLKKIPGDNSDKWKQIPNCENVRTTQCVFPKNTFRKGIYLIRVRASDGNTTSV
WSNEEKFDTQFQITLLPPVIAMKSTNDVSLRVYISATEEPENRAMNHPYPLTYEIVFWEN
TSNAERKIVDKRTDFTFPKLKPLTAYCVKARALIQDEKWNKSSVFSDTVCEKTKPGNTSK
TWLIAGVCAALLSIPVVVYVMKLLCRCIGYVFFPSSKPPSAIDEYFSEQPLRNLLLFTSE
EQTERCFIIENTNTIIAIEETHQTDGEHKKYNSQTSQDSGNYSNEDESSESKLSEEFVHQ
ETE
NT seq 1632 nt   +upstreamnt  +downstreamnt
ttcgtggtccctttatttctaggaggaacaaatctaaagtctcctcaaaatgtagaggtc
tacatcgttgatgatacctttatcctgagatgggacgggagcagtccatctgtcaggaat
gtgactttttcagcagattatcaaacacttgaaaatgatacttggttaaaattgcctgga
tgtcagtctattgccaataccaaatgcaacttttcttcactcaagctcaatatttacgaa
gaaattaagttgcgaataagagcagagaagggaaacaacacttctccgtggcattatgtt
gactcattcaccctatttggaaaagctcaaattggtcccccaaaagtacatttagaagcc
gaagataaggcaataataataaacatcaccccacctggaacaaaaggtcgtggcatgtgg
tctctggatagctcaagctttacctacagcttagagatctggaaaaactcttcaagtgga
gacagaaggactgaaactgtttaccccagagataaaatttataaactctcaccagagacc
acttactgtttaaaagttaaagcaagacttttgccgagaaaaattggtgtctttagtcct
gtgtattgtataaagaccacagttgaaaataaactgcctccaccagaaaatattcaagtt
gatgctgaaaatcgcatctatgttcttaaatgggattacgcatatgaaaatgtgactttt
caagctcagtggctccatgcctatttaaaaaagattcctggggacaattcagataaatgg
aaacaaataccaaactgtgaaaatgtccgaactacgcagtgtgtctttcccaaaaatact
ttccgaaaaggaatttaccttatccgtgttcgagcatctgatggaaataccacatctgtt
tggtctaacgaagaaaaatttgatactcaattccaaattaccctgcttcctccagtcatt
gccatgaaatccactaacgatgtttccctgcgggtctatatcagcgccacagaagagcct
gaaaacagggctatgaaccatccttacccactaacttatgaaattgtattttgggaaaac
acttcaaatgctgagagaaaaattgtggataaaagaactgattttacttttccaaaattg
aaaccactaactgcatattgtgtcaaagccagagccctcattcaggatgaaaagtggaat
aaaagcagtgttttcagtgacactgtgtgcgagaaaacaaaaccaggaaatacttccaaa
acctggctcatagccggagtgtgcgctgcgttactttccatcccggttgtcgtctatgtc
atgaaacttctctgtagatgtatcggttatgtgttcttcccatcaagtaagcctccttcc
gctatagatgagtatttctctgagcaaccactccggaatctcctccttttcacgtccgag
gaacaaacggaaaggtgttttatcattgaaaatacaaacactatcattgcaatagaagaa
actcaccaaactgatggagagcacaaaaaatacaattcccaaaccagtcaagattcggga
aactattctaatgaagatgaaagcagtgaaagcaaattgagtgaagaattcgtgcaccag
gaaaccgagtga

DBGET integrated database retrieval system