KEGG   Ursus maritimus (polar bear): 103673552
Entry
103673552         CDS       T03271                                 

Gene name
PLCB2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00562  Inositol phosphate metabolism
umr01100  Metabolic pathways
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04062  Chemokine signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04310  Wnt signaling pathway
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04621  NOD-like receptor signaling pathway
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04742  Taste transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05022  Pathways of neurodegeneration - multiple diseases
umr05142  Chagas disease
umr05143  African trypanosomiasis
umr05146  Amoebiasis
umr05163  Human cytomegalovirus infection
umr05200  Pathways in cancer
Module
umr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103673552 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103673552 (PLCB2)
   04310 Wnt signaling pathway
    103673552 (PLCB2)
   04371 Apelin signaling pathway
    103673552 (PLCB2)
   04020 Calcium signaling pathway
    103673552 (PLCB2)
   04070 Phosphatidylinositol signaling system
    103673552 (PLCB2)
   04072 Phospholipase D signaling pathway
    103673552 (PLCB2)
   04071 Sphingolipid signaling pathway
    103673552 (PLCB2)
   04022 cGMP-PKG signaling pathway
    103673552 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103673552 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103673552 (PLCB2)
   04621 NOD-like receptor signaling pathway
    103673552 (PLCB2)
   04062 Chemokine signaling pathway
    103673552 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    103673552 (PLCB2)
   04922 Glucagon signaling pathway
    103673552 (PLCB2)
   04929 GnRH secretion
    103673552 (PLCB2)
   04912 GnRH signaling pathway
    103673552 (PLCB2)
   04915 Estrogen signaling pathway
    103673552 (PLCB2)
   04921 Oxytocin signaling pathway
    103673552 (PLCB2)
   04926 Relaxin signaling pathway
    103673552 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    103673552 (PLCB2)
   04918 Thyroid hormone synthesis
    103673552 (PLCB2)
   04919 Thyroid hormone signaling pathway
    103673552 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    103673552 (PLCB2)
   04916 Melanogenesis
    103673552 (PLCB2)
   04924 Renin secretion
    103673552 (PLCB2)
   04925 Aldosterone synthesis and secretion
    103673552 (PLCB2)
   04927 Cortisol synthesis and secretion
    103673552 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103673552 (PLCB2)
   04270 Vascular smooth muscle contraction
    103673552 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    103673552 (PLCB2)
   04971 Gastric acid secretion
    103673552 (PLCB2)
   04972 Pancreatic secretion
    103673552 (PLCB2)
   04973 Carbohydrate digestion and absorption
    103673552 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103673552 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103673552 (PLCB2)
   04725 Cholinergic synapse
    103673552 (PLCB2)
   04728 Dopaminergic synapse
    103673552 (PLCB2)
   04726 Serotonergic synapse
    103673552 (PLCB2)
   04720 Long-term potentiation
    103673552 (PLCB2)
   04730 Long-term depression
    103673552 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    103673552 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    103673552 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    103673552 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103673552 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103673552 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103673552 (PLCB2)
   05016 Huntington disease
    103673552 (PLCB2)
   05017 Spinocerebellar ataxia
    103673552 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    103673552 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103673552 (PLCB2)
   04934 Cushing syndrome
    103673552 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103673552 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103673552 (PLCB2)
   05142 Chagas disease
    103673552 (PLCB2)
   05143 African trypanosomiasis
    103673552 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103673552 (PLCB2)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103673552 (PLCB2)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103673552 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103673552 (PLCB2)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y C2 EF-hand_like Gp58 Lectin_N
Other DBs
NCBI-GeneID: 103673552
NCBI-ProteinID: XP_008700556
UniProt: A0A384D0K9
LinkDB
Position
Un
AA seq 1093 aa
MSLLSPVLLPPKVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNMDFPDNNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGQNWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNPEGKIPVKNFFAPLVFSKVE
AALSACHLPKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEHLT
KFINQKQRDPRLNSLLFPPARPDQVRGLIDKYEPSGINVQRGQLSPEGMVWFLCGPENSV
LAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDCWK
GKPPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKMAE
YCRMMFGDMLLTEPLEKFPLSPGTPLPSPEDLRGKILIKNKKNQFSGPAAPSTEPGEEAS
VGDDTVWAGEEGAEPEEEEEEEEEEEEEEEEEESGNLDEEEIKKMQSDEGTAGLEVTAYE
EMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQMSRIY
PKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMRRP
DKQFNPFSVDRIDVVVATTLSITVISGQFLSDRSVRTYVEVELFGLPGDPKRRYRTKLSP
SANSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHLCLHS
ESNMPLTMPALFVFLEMKDYVPDTWADLTVALANPIKFFSAQDKKSVKLKEAMGGLPEKP
FPPGSPVVGPVNGTLAPTSNGSADFHLGWDPLCRKPWRLESALKGAHTATPPRGAGRSLP
EPGAPGAPVSPPSCPCTTPQQISKMMELAREKQAAELKTLKETLETDTKEMKKKLEAKSL
ERIQAMVKITSDKMAQERLKREINNSHIQEVVQVIKQMTENLEKHQEKLEEKQAACLEQI
REMEKQFQQEALAEYEARMKGLEAEVKESVKACLRDCLPSQAKDKPERPCEAFRELCEQD
PLTVKTGAQESRL
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgtctctgctcagcccggtcctgctgccccccaaggtgaaggcttatctgagccaaggg
gagcgcttcatcaaatgggacgatgaaaccacaatagcctccccggttatcctccgtgtg
gatcccaagggctactacttatattggacatatcagagtaaggagatggagtttctggat
atcaccagcatcagggatacccgctttgggaagtttgccaagatacccaagagccagaag
ctccgggatgtcttcaacatggacttccctgacaacaacttcctgcttaagacgctcact
gtggtgtccggccctgacatggtggacctcaccttccacaacttcgtctcctacaaggag
aatgtgggccagaactgggccgaagatgtgctggctctggtcaagcacccgctgacagcc
aatgcctcccgcagcaccttcttggacaaaatcctggtcaagctcaagatgcagctcaac
cctgaagggaagattcctgtgaaaaatttctttgctcctttagttttttccaaagtggaa
gctgccctcagcgcctgccacctcccaaaaggcaagaatgatgccatcaatcctgaggac
ttcccagaatccgtctacaagagtttcctcatgagcctctgtcctcggccagaaatagac
gagatcttcacttcctaccatgccaaggccaaaccctacatgaccaaggagcacttgacc
aagttcatcaaccagaaacagagggacccccgtctcaactctttgctgtttccgccggcg
cggcctgaccaggtgcggggcctcatcgacaagtatgagcccagtggcatcaacgtgcag
aggggccagctctccccggagggcatggtgtggttcctctgtgggcccgagaacagcgtg
ctggcccaggacaagctgcttctccaccatgacatgactcagccactcaaccattacttc
atcaactcctcacacaacacctacctgacagccggccagttctctggcctttcctcggcc
gagatgtaccgccaggtgctgctcgctggctgccgctgtgtggagctggactgctggaag
ggcaagccccctgacgaggagcccattatcacccacggcttcaccatgaccacggacatc
tacttcaaggaagcaattgaagccatcgcagaaagtgcctttaagacctccccctatcct
gtcatcctgtcatttgaaaaccatgtggactcaccccgccaacaggccaagatggctgag
tactgccggatgatgtttggggatatgctgctcacagagcccctggaaaagttcccgttg
agcccaggcacccccctgcccagccctgaggatctccgaggcaagatcctcatcaagaat
aaaaagaaccagttttctggcccagcggcccccagcacggagcctggagaggaggcctct
gtgggggacgacacagtgtgggctggcgaggaaggggcagagccggaggaggaagaggag
gaagaggaggaggaggaggaggaggaggaggaggaagagtcgggaaacctggatgaggag
gagatcaagaagatgcagtcggatgagggcacagcgggcctggaggtgacagcttatgag
gagatgtccagcctagtgaattacatccagcccaccaagttcatctcctttgagttctct
gcccagaagaaccgaagttatgtcatctcgtctttcacagagctcaaggcctatgacctg
ctctccaaggcctcggtgcagtttgtggactacaacaagcgccagatgagccgcatttac
cctaagggcacccgcatggactcctccaactacatgccccagatgttctggaacgccggt
tgccagatggttgccctcaacttccagacgatggacctgcccatgcagcagaacatggcg
ctgtttgagttcaatgggcagagtggctacctgctcaagcatgagttcatgcggcggcca
gacaagcagttcaaccccttctccgtggaccgcatcgacgtggtggtagccaccaccctt
tccatcacggtgatctctgggcagttcctgtcggatcgcagtgtgcgcacgtatgtggaa
gtggaactgtttggccttcctggggaccccaagaggcgctatcgcaccaagctgtcaccc
agcgccaactccatcaatcctgtctggaaggaggagccttttgtctttgagaagatcttg
atgcctgagctggcctccctcagggtggctgtaatggaagaaggcaacaaatttcttggg
caccgcatcatccccattaacgccctgaattctggctaccaccacctgtgcctgcacagc
gagagcaacatgccccttaccatgcctgcactttttgtcttcctggagatgaaggactat
gtacctgacacctgggcagatctcaccgtagctctcgccaatcccatcaagttcttcagt
gcccaggataagaagtctgtgaagctcaaggaagccatgggaggtctgcccgagaaaccc
ttcccacctgggagtccagttgtcggcccggtcaacgggacattggccccaacgagcaac
gggtctgcagactttcacctgggatgggacccactgtgtcggaagccttggcgcttggaa
agtgcgctaaagggggcccatactgccacacccccccggggggcggggaggagcctgcca
gaaccaggggcccccggggcacctgtcagcccaccctcctgtccctgcaccaccccgcag
caaatctccaagatgatggagctggccagagagaagcaggctgcagagctgaagaccctc
aaggagaccttggagactgacaccaaagagatgaagaaaaagctggaggccaagagcctg
gagcggattcaggccatggtcaaaatcacctcagacaagatggctcaggaaaggctgaag
agagagattaacaactctcacatccaggaggtggtgcaagtcattaagcagatgacagag
aacctggagaagcaccaggagaagctagaggagaagcaggcagcctgcctggaacagatc
cgggagatggaaaagcagttccagcaggaggcgctggcagaatacgaggccaggatgaag
ggcctggaggctgaggtgaaggagtcagtgaaggcctgcctcagggactgcttaccctct
caggccaaggacaagcctgagaggccctgtgaggccttcagggagctgtgtgagcaggac
ccactcacagtaaagacgggcgcccaggagagccgcctctga

KEGG   Ursus maritimus (polar bear): 103674425
Entry
103674425         CDS       T03271                                 

Gene name
PLCB1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00562  Inositol phosphate metabolism
umr01100  Metabolic pathways
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04062  Chemokine signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04310  Wnt signaling pathway
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04621  NOD-like receptor signaling pathway
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04742  Taste transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05022  Pathways of neurodegeneration - multiple diseases
umr05142  Chagas disease
umr05143  African trypanosomiasis
umr05146  Amoebiasis
umr05163  Human cytomegalovirus infection
umr05200  Pathways in cancer
Module
umr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103674425 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103674425 (PLCB1)
   04310 Wnt signaling pathway
    103674425 (PLCB1)
   04371 Apelin signaling pathway
    103674425 (PLCB1)
   04020 Calcium signaling pathway
    103674425 (PLCB1)
   04070 Phosphatidylinositol signaling system
    103674425 (PLCB1)
   04072 Phospholipase D signaling pathway
    103674425 (PLCB1)
   04071 Sphingolipid signaling pathway
    103674425 (PLCB1)
   04022 cGMP-PKG signaling pathway
    103674425 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103674425 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103674425 (PLCB1)
   04621 NOD-like receptor signaling pathway
    103674425 (PLCB1)
   04062 Chemokine signaling pathway
    103674425 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    103674425 (PLCB1)
   04922 Glucagon signaling pathway
    103674425 (PLCB1)
   04929 GnRH secretion
    103674425 (PLCB1)
   04912 GnRH signaling pathway
    103674425 (PLCB1)
   04915 Estrogen signaling pathway
    103674425 (PLCB1)
   04921 Oxytocin signaling pathway
    103674425 (PLCB1)
   04926 Relaxin signaling pathway
    103674425 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    103674425 (PLCB1)
   04918 Thyroid hormone synthesis
    103674425 (PLCB1)
   04919 Thyroid hormone signaling pathway
    103674425 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    103674425 (PLCB1)
   04916 Melanogenesis
    103674425 (PLCB1)
   04924 Renin secretion
    103674425 (PLCB1)
   04925 Aldosterone synthesis and secretion
    103674425 (PLCB1)
   04927 Cortisol synthesis and secretion
    103674425 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103674425 (PLCB1)
   04270 Vascular smooth muscle contraction
    103674425 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    103674425 (PLCB1)
   04971 Gastric acid secretion
    103674425 (PLCB1)
   04972 Pancreatic secretion
    103674425 (PLCB1)
   04973 Carbohydrate digestion and absorption
    103674425 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103674425 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103674425 (PLCB1)
   04725 Cholinergic synapse
    103674425 (PLCB1)
   04728 Dopaminergic synapse
    103674425 (PLCB1)
   04726 Serotonergic synapse
    103674425 (PLCB1)
   04720 Long-term potentiation
    103674425 (PLCB1)
   04730 Long-term depression
    103674425 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    103674425 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    103674425 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    103674425 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103674425 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674425 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103674425 (PLCB1)
   05016 Huntington disease
    103674425 (PLCB1)
   05017 Spinocerebellar ataxia
    103674425 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    103674425 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103674425 (PLCB1)
   04934 Cushing syndrome
    103674425 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103674425 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103674425 (PLCB1)
   05142 Chagas disease
    103674425 (PLCB1)
   05143 African trypanosomiasis
    103674425 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103674425 (PLCB1)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103674425 (PLCB1)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103674425 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103674425 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like PH_14 C2 DUF1154
Other DBs
NCBI-GeneID: 103674425
NCBI-ProteinID: XP_008701560
UniProt: A0A384D493
LinkDB
Position
Un
AA seq 1072 aa
MITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKL
QVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCP
RPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPN
NSLAKKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLA
GNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFK
TSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYK
ILVKNKKKSHKSSEGSGKKKLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCK
KSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTK
SPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYE
YNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDM
FGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRI
LPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLME
QRAKQLAALTLEDEEEVKKEADPGETPSEAPSEARTTPAENGVNHTTSLAPKPPSQALHS
QPAPGSVKAPAKTEDLIQSVLTEVEAQTIDELKQQKSFVKLQKKHYKEMKDLVKRHHRKT
TDLIKEHTTKYNEIQNDYLRRRAALEKTAKKDSKKKSDPSSPDHGSSTIEQDLAALDAEM
TQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQMKKLKEIC
EKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQ
EKLVEKHKEIRQQILDEKPKGDGSSSFLSETCHEDPSVSPNFTPPNPQALKW
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgataacagtggtgtatgggcctgacttggttaacatctcccacttgaatctcgtggct
ttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaacctg
ctggcccaaaacatgtcaagagatgcatttctggaaaaagcctatactaagcttaagctg
caagtcactccagaagggcgcattcctctcaaaaacatataccgcttgttctcagcagac
cggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaacgattca
atacctcaagaagatttcactccagaagtgtacagagttttcctgaacaatctttgccct
cgacctgaaattgataacatcttttccgaatttggtgccaaaagcaaaccataccttacc
gtcgatcagatgatggactttatcaatcttaagcagagagatccccggctaaatgaaata
ctttatccacctttaaagcaagaacaagtccaagtattgattgagaagtatgagcccaac
aatagcctcgccaaaaaaggacagatatcagtggatggctttatgcgctatctaagtgga
gaagaaaatggagtcgtttcgcctgagaaactggatttgaatgaagatatgtctcagccc
ctttctcactatttcatcaattcctcacacaacacctacctcacagctggccagttggct
ggaaactcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtggag
ttggactgctggaagggacggactgctgaagaggaaccagtcatcacccatgggttcacc
atgacaactgaaatatccttcaaggaagtgatagaagcaatcgctgagtgtgcatttaag
acatcaccttttccaattctgctttcatttgagaaccacgtagattctccaaagcagcaa
gccaagatggcggagtattgccgactgatctttggagatgctcttctcatggaaccactg
gaaaaatacccactggaatctggagttcctcttccaagtcctatggatttaatgtacaaa
attttggtgaaaaataagaagaaatcgcacaagtcatcagaaggaagtggcaaaaagaag
ctctcggaacaagcctccaacacgtacagtgactcctccagcgtgtttgaaccctcgtct
ccaggagccggggaagctgataccgagagtgatgatgatgatgatgatgatgactgtaaa
aaatcttcaatggatgaggggactgctgggagtgaggccatggccaccgaagagatgtct
aacctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaagaga
aatagaagttttgaaatgtcttccttcgtggaaaccaaaggtctcgagcagctgacgaaa
tcgccagtggaatttgtagaatacaacaaaatgcagcttagcaggatatatccaaaagga
acccgtgtggattcatctaactacatgcctcagctcttctggaatgcgggttgccaaatg
gttgcacttaattttcaaactgtggacctggctatgcagataaatatggggatgtacgaa
tacaatgggaaaagtggctacagattaaagccagagttcatgaggagacctgacaagcat
tttgatccattcaccgaaggcatcgtggatgggatagtggccaacactttatctgtcaag
attatttcaggtcagtttctttctgataagaaagttgggacttacgtggaagtggatatg
tttggtttgcctgtggacacgaggaggaaggcgtttaagaccaaaacatcacaaggaaat
gctgtaaatcctgtctgggaagaggagcccattgtgttcaaaaaggtggttcttccttcg
ctggcctgtttgaggatagcagtttatgaagaagggggtaaatttatcggtcaccggatc
ttgccagtacaggcgattcggccaggctatcactacatctgtctgaggaatgagaggaac
cagcctctgacgctcccagctgtctttgtctacatagaggtgaaagactatgtcccagat
acatatgcagatgtgattgaagctttgtcaaatccaatacgatatgtgaatctgatggag
caaagagctaaacagttggctgctttgacactggaagatgaagaagaagtaaagaaagag
gccgatcctggggaaacaccgtcagaagctccaagtgaagccaggacaacgccagcagaa
aatggagtgaatcacactacgtccctggcacccaaaccaccttcccaggctctccacagc
caaccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagtgtt
ttaacagaagtggaagcccagaccatcgacgagctaaagcagcagaaatcgtttgtgaaa
cttcaaaagaaacactacaaagaaatgaaagacctggttaaaagacaccacaggaaaacc
actgaccttatcaaggagcacactacaaaatataatgaaattcagaatgattacttgagg
aggagggcagctttggagaagacagccaaaaaggacagtaagaaaaaatcagatcctagc
agtcctgaccatggttcgtcaacgattgagcaagatcttgctgccctagatgccgaaatg
acccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgacaa
gagcagtattacagtgaaaaataccagaagcgagagcatattaaactgcttattcaaaag
ttgacggatgttgctgaagaatgtcagaacaatcagatgaagaagctcaaagaaatctgt
gagaaagagaagaaggaattaaagaagaagatggacaaaaaaaggcaggagaagataaca
gaagctaaatccaaagacaaaagtcaaatggaagaggaaaagacagagatgatccggtca
tacatccaggaggtggtgcagtacatcaagaggttagaagaggcccaaagtaaacggcaa
gaaaaacttgtagagaaacacaaggagatacgtcagcagatcctggacgaaaagcccaag
ggggacggttcctcctcattcttgtcggaaacttgccatgaggatccctctgtttccccc
aactttactccccccaaccctcaagctctcaagtggtga

KEGG   Ursus maritimus (polar bear): 103674426
Entry
103674426         CDS       T03271                                 

Gene name
PLCB4
Definition
(RefSeq) phospholipase C beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00562  Inositol phosphate metabolism
umr01100  Metabolic pathways
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04062  Chemokine signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04310  Wnt signaling pathway
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04621  NOD-like receptor signaling pathway
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04742  Taste transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05022  Pathways of neurodegeneration - multiple diseases
umr05142  Chagas disease
umr05143  African trypanosomiasis
umr05146  Amoebiasis
umr05163  Human cytomegalovirus infection
umr05200  Pathways in cancer
Module
umr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103674426 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103674426 (PLCB4)
   04310 Wnt signaling pathway
    103674426 (PLCB4)
   04371 Apelin signaling pathway
    103674426 (PLCB4)
   04020 Calcium signaling pathway
    103674426 (PLCB4)
   04070 Phosphatidylinositol signaling system
    103674426 (PLCB4)
   04072 Phospholipase D signaling pathway
    103674426 (PLCB4)
   04071 Sphingolipid signaling pathway
    103674426 (PLCB4)
   04022 cGMP-PKG signaling pathway
    103674426 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103674426 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103674426 (PLCB4)
   04621 NOD-like receptor signaling pathway
    103674426 (PLCB4)
   04062 Chemokine signaling pathway
    103674426 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    103674426 (PLCB4)
   04922 Glucagon signaling pathway
    103674426 (PLCB4)
   04929 GnRH secretion
    103674426 (PLCB4)
   04912 GnRH signaling pathway
    103674426 (PLCB4)
   04915 Estrogen signaling pathway
    103674426 (PLCB4)
   04921 Oxytocin signaling pathway
    103674426 (PLCB4)
   04926 Relaxin signaling pathway
    103674426 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    103674426 (PLCB4)
   04918 Thyroid hormone synthesis
    103674426 (PLCB4)
   04919 Thyroid hormone signaling pathway
    103674426 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    103674426 (PLCB4)
   04916 Melanogenesis
    103674426 (PLCB4)
   04924 Renin secretion
    103674426 (PLCB4)
   04925 Aldosterone synthesis and secretion
    103674426 (PLCB4)
   04927 Cortisol synthesis and secretion
    103674426 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103674426 (PLCB4)
   04270 Vascular smooth muscle contraction
    103674426 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    103674426 (PLCB4)
   04971 Gastric acid secretion
    103674426 (PLCB4)
   04972 Pancreatic secretion
    103674426 (PLCB4)
   04973 Carbohydrate digestion and absorption
    103674426 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103674426 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    103674426 (PLCB4)
   04725 Cholinergic synapse
    103674426 (PLCB4)
   04728 Dopaminergic synapse
    103674426 (PLCB4)
   04726 Serotonergic synapse
    103674426 (PLCB4)
   04720 Long-term potentiation
    103674426 (PLCB4)
   04730 Long-term depression
    103674426 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    103674426 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    103674426 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    103674426 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103674426 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674426 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103674426 (PLCB4)
   05016 Huntington disease
    103674426 (PLCB4)
   05017 Spinocerebellar ataxia
    103674426 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    103674426 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103674426 (PLCB4)
   04934 Cushing syndrome
    103674426 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103674426 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103674426 (PLCB4)
   05142 Chagas disease
    103674426 (PLCB4)
   05143 African trypanosomiasis
    103674426 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103674426 (PLCB4)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103674426 (PLCB4)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103674426 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103674426 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 103674426
NCBI-ProteinID: XP_008701564
UniProt: A0A384D446
LinkDB
Position
Un
AA seq 1187 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSVRLGATPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPTAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESTAPVSILEDDNEEEIESADQEEEAHPEYKFGNELSADDLGHKEAVANSVKKASD
DLEHEINKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNRLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQ
SSSELRPTTTVALGSGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLISAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
NT seq 3564 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagttccttcctttttgcaagaagga
gctgtttttgacagatatgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgaatttggcttctttctgacctggaggagtgaaggcaaggaaggacaagtgcta
gaatgctccctcatcaacagtgttcgcctgggagccaccccaaaggatcccaaaatcctg
gccgctcttgaagctgttggaaagtcagagaatgatctggaagggcggatagtttgtgtc
tgcagtggcacggatctggtgaacatcagtttcacatacatggtggctgaaaatccggaa
gtaactaagcaatgggtagaaggactgagatcaatcatacacaacttcagggccaacaat
gtcagtccaatgacctgcctcaagaagcactggatgaaattggcgtttatgaccaacaca
aacggtaaaattccagttaggagcattactagaacctttgcatcggggaaaacagaaaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cctacagcctttacatacgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaggatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcagcgagaccctcgactgaatgaaattttattc
ccattttatgatgctaaaagggcaatgcagatcatcgagatgtatgagcctgatgaagac
ttgaagaaaaaaggcctcatatcaagcgacgggttttgcagatatctgatgtccgatgaa
aatgccccagtcttcctggatcgtttagaactttaccaagaaatggaccatcccctggcc
cactacttcatcagttcttcccacaacacctatctcacgggccgacagtttggcgggaaa
tcttcagtagaaatgtacagacaggtgctcctggctggttgcagatgtgttgaacttgac
tgttgggatggaaaaggtgaagaccaagaaccaataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgttattcaagccatcaaggaaaccgcatttgtcacgtcc
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggacctcctgttgaaacaagcacttgaatcacat
ccacttgaaccaggcaggcccttaccatcccccaatgacctcaaaagaaaaatactcatc
aaaaataaacggctgaaacctgaggttgaaaaaaaacagctcgaagctttgaaaagcatg
atggaagctggagaatccactgccccagttagcatcctagaggacgataatgaagaggag
atagaaagtgctgaccaagaggaggaggctcacccggaatacaaatttggaaacgaactt
tctgctgatgacttgggccacaaggaggctgttgccaatagtgtcaagaaggcttcagat
gaccttgaacatgaaatcaacaaaaagggcctggtcactgtggaagatgaacaggcatgg
atggcatcgtataaatacgtaggtgctaccactaatatccatccgtatttgtctacaatg
atcaactatgcacagcctgtaaagttccaaggtttccatgtggctgaagagcgcaatatc
cattataacatgtcttcttttaatgagtccgtcggtctgggctatttgaagacacacgcg
attgaatttgtgaattataacaaacggcaaatgagccgcatttaccccaagggaggccgg
gtcgattccagtaattacatgcctcagattttctggaatgctggctgccagatggtttcg
ctgaactatcaaaccccagatttagcgatgcaattgaatcagggaaaatttgagtataat
ggatcgtgcgggtacctcctcaaaccagatttcatgagacggccggatcgaacgttcgat
cccttctctgaaactcctgttgatggggttattgcagccacttgctcagtgcaggtcata
tcaggtcagtttttatcagataagaaaattggtacatacgtagaagtggatatgtacggg
ttgcccactgacaccatacgtaaggaattccgaactcgcatggtgatgaacaacggactc
aatccagtttacaatgaagaatcctttgtgtttcggaaggtaatcctccctgacctggca
gtcttgagaatagcagtgtatgatgacaacaacaggctgataggccagaggattcttcca
ctggatggcctccaagcaggctatcgacacatttctcttcgaaatgagggaaataaacca
ttatcactgccaacaattttctgcaatattgttcttaaaacatatgtgcctgacggattt
ggagatattgtggatgctttatcagatccaaagaaatttctttccattacggaaaagaga
gcagaccaaatgagagctatgggcattgaaactagtgacatagcagatgtgcccagtgat
acttctaagaatgacaagaaaggaaaagccaacactgccaaagcaaacgtgaccccacag
agcagctccgagctcagaccaaccaccacggtggccctggggtctggcgtggaagccaag
aaaggtatcgaacttatccctcaagtgaggatagaagatttaaagcagatgaaggcttac
ttgaagcatttaaagaaacaacagaaggagctaaattctttaaagaagaaacatgcaaag
gagcacagcacaatgcagaagttgcactgcacgcaagttgacaaaattgtggcccagtat
gacaaagagaagtcaacgcatgagaaaatcctagagaaggcgatgaagaagaagggggga
agtaattgtctcgaaatgaaaaaagaaaccgaaattaaaattcagacactgacatcagat
cacaaatctaaggtcaaagagatagtggcccagcacacaaaggagtggtcagaaatgatc
aacacccacagtgctgaggagcaagagatccgggacctccacctcagccagcagtgtgag
ctcctgcgaaagctactgatcagtgcccacgagcagcaaacccagcagctcaaactgtcc
catgacagggaaagcaaggaaatgcgagcacaccaggctaagatttctatggaaaacagc
aaagccatcagccaagataaatctatcaagaacaaagcagaacgggaaaggcgagtcagg
gaattaaatagcagcaacaccaaaaagtttctggaagaaagaaagagactcgcaatgaaa
cagtccaaagaaatggatcagttgaaaaaagtccagcttgaacacctcgagttcctagag
aaacagaatgaacaggcgaaggagatgcagcagatggtgaagttggaagccgagatggac
cgcaggccagcaacagtagtgtga

KEGG   Ursus maritimus (polar bear): 103679549
Entry
103679549         CDS       T03271                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00562  Inositol phosphate metabolism
umr01100  Metabolic pathways
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04062  Chemokine signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04310  Wnt signaling pathway
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04611  Platelet activation
umr04621  NOD-like receptor signaling pathway
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04728  Dopaminergic synapse
umr04730  Long-term depression
umr04742  Taste transduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04918  Thyroid hormone synthesis
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04961  Endocrine and other factor-regulated calcium reabsorption
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr04972  Pancreatic secretion
umr04973  Carbohydrate digestion and absorption
umr05010  Alzheimer disease
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05022  Pathways of neurodegeneration - multiple diseases
umr05142  Chagas disease
umr05143  African trypanosomiasis
umr05146  Amoebiasis
umr05163  Human cytomegalovirus infection
umr05200  Pathways in cancer
Module
umr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103679549 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103679549 (PLCB3)
   04310 Wnt signaling pathway
    103679549 (PLCB3)
   04371 Apelin signaling pathway
    103679549 (PLCB3)
   04020 Calcium signaling pathway
    103679549 (PLCB3)
   04070 Phosphatidylinositol signaling system
    103679549 (PLCB3)
   04072 Phospholipase D signaling pathway
    103679549 (PLCB3)
   04071 Sphingolipid signaling pathway
    103679549 (PLCB3)
   04022 cGMP-PKG signaling pathway
    103679549 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103679549 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103679549 (PLCB3)
   04621 NOD-like receptor signaling pathway
    103679549 (PLCB3)
   04062 Chemokine signaling pathway
    103679549 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    103679549 (PLCB3)
   04922 Glucagon signaling pathway
    103679549 (PLCB3)
   04929 GnRH secretion
    103679549 (PLCB3)
   04912 GnRH signaling pathway
    103679549 (PLCB3)
   04915 Estrogen signaling pathway
    103679549 (PLCB3)
   04921 Oxytocin signaling pathway
    103679549 (PLCB3)
   04926 Relaxin signaling pathway
    103679549 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    103679549 (PLCB3)
   04918 Thyroid hormone synthesis
    103679549 (PLCB3)
   04919 Thyroid hormone signaling pathway
    103679549 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    103679549 (PLCB3)
   04916 Melanogenesis
    103679549 (PLCB3)
   04924 Renin secretion
    103679549 (PLCB3)
   04925 Aldosterone synthesis and secretion
    103679549 (PLCB3)
   04927 Cortisol synthesis and secretion
    103679549 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103679549 (PLCB3)
   04270 Vascular smooth muscle contraction
    103679549 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    103679549 (PLCB3)
   04971 Gastric acid secretion
    103679549 (PLCB3)
   04972 Pancreatic secretion
    103679549 (PLCB3)
   04973 Carbohydrate digestion and absorption
    103679549 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103679549 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103679549 (PLCB3)
   04725 Cholinergic synapse
    103679549 (PLCB3)
   04728 Dopaminergic synapse
    103679549 (PLCB3)
   04726 Serotonergic synapse
    103679549 (PLCB3)
   04720 Long-term potentiation
    103679549 (PLCB3)
   04730 Long-term depression
    103679549 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    103679549 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    103679549 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    103679549 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103679549 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679549 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103679549 (PLCB3)
   05016 Huntington disease
    103679549 (PLCB3)
   05017 Spinocerebellar ataxia
    103679549 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    103679549 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103679549 (PLCB3)
   04934 Cushing syndrome
    103679549 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103679549 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103679549 (PLCB3)
   05142 Chagas disease
    103679549 (PLCB3)
   05143 African trypanosomiasis
    103679549 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103679549 (PLCB3)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103679549 (PLCB3)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103679549 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103679549 (PLCB3)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PI-PLC-Y PH_14 EF-hand_like C2 BPL_N
Other DBs
NCBI-GeneID: 103679549
NCBI-ProteinID: XP_008707335
UniProt: A0A384DKL7
LinkDB
Position
Un
AA seq 1255 aa
MSGLTGCHGALRDTKAEASSRNLVTLRVDSNGFFLYWTGPNMEVDTLDISSIRDTRTGRY
ARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNFMAVQDDTAKVWTEELFK
LAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFSADKKRVETALESCGLNF
NRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPYLTLEQLMDFINQKQRDP
RLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYLGGEENGILPLEALDLST
DMTQPLSSYFINSSHNTYLTGREQETPWWCSSAGRRPEAGRVLGQVEALLGGCRCVELDV
WKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAKQQAKM
AEYWRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSTGVPNSSVRKR
PLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGPEKPSLEPQKSLGEDGLPR
GPDALGSADREDEEEEEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPVKFKSF
EAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYMPQLFW
NVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIVDGIVA
NALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEPFDFPK
ALHVSGSGSGSWPSVVFEKRTRSLRPFISLVVVPTAPCDRRGAQARRAEGSRPGALGSPG
RLEPAFLGKSLLLSPRQAQAGPETCQETQSQQLGSQLTPNPTPSPRGTSPRRPPGPVTSP
TSPSLSSPGQRDDLIASLLSEVAPTPLDELRGHKALVKLRSRQERGLHSVPPSLPGCQAA
VEVPHEERVCPETVAPTGSQRLHGANGPRCWHPRPCPHPSRGWCPPLPVGICPVRPCPPS
PSPCDNQRVTQRGSSYRGGENEKEEEEEVRRYQEFQKRQVQSLLELREAQVDTEAERRLE
HLRQAQQRLREIVLDFHTTQFKRLKEMNEREKKELQKILDRKRHNSISEAKTREKHKKEA
ELTEINRRHITESVNSIRRLEEAQKQRHERLVAGQQQVLQQLAEEEPKLLAQLAQECQEQ
RARLPQEIRRSLLGDTPEGLGDGRLVACASNGHAPGSGGHLSGADSESQEENTKL
NT seq 3768 nt   +upstreamnt  +downstreamnt
atgtcagggctgactggttgtcatggggccctgagggacacaaaagcggaggcctccagt
cggaacctggtaaccctgcgtgtggactcgaatggcttctttctgtactggaccggaccc
aacatggaggtggacacactggacatcagttccatcagggacacgcggacggggcgttac
gcccgcctgcccaaggaccccaagatccgggaggtgctgggctttgggggccctgacgcc
cggctggaggagaagttgatgacggtggtggctgggccagacccagtgaatacaacgttc
ttgaacttcatggccgtgcaggatgacacagccaaggtctggaccgaggagctgttcaag
ctggctatgaacatcctggctcagaacgcctcccggaacaccttcctgcgaaaagcatac
acaaagctgaagctgcaagtgaaccaggacggacggatcccggtgaagaatatcctgaag
atgttttcagcagataaaaagcgagtagagactgcactggaatcctgtggcctcaatttc
aaccggagtgagtccatccggccggacgaattttccttggaaatcttcgagcggttcctg
aataagttgtgtttgcggccagacattgacaagatcctgctggagataggcgccaagggc
aagccgtatctgacgctggagcagctcatggacttcatcaaccagaagcaacgggacccg
aggctcaacgaagtgctgtacccacccctgcggccctcgcaggcccggctgctcattgag
aagtatgagcccaaccagcagttcctggagcgagaccagatgtccatggagggcttcagc
cgctacctgggaggtgaggagaacggcatcctgcctctggaggccctggatctgagcaca
gacatgacccagccgctgagctcctacttcatcaactcctcgcacaacacctatctcaca
ggccgggagcaggagactccttggtggtgctcttcggcgggaaggaggccggaggccggg
cgggtgctggggcaggtggaggcgctgctggggggctgccgctgcgtggagctggatgtg
tggaaagggcggccgcccgaggaggagcccttcatcacccacggcttcaccatgaccacc
gaggtgccgctgcgagatgtgctcgaggccatcgcggaaaccgccttcaagacctcgccc
taccccgtcatcctctccttcgagaaccacgtggactcggcaaagcagcaggccaagatg
gccgagtactggcgttccatctttggggacgcgctgctcattgacccactggacaagtac
ccgctggccccaggcgtccccctgcccagcccccaggacctgatgggccgcatcctggtg
aagaacaaaaagcgacaccggcccagcactggtgtccccaacagctctgtgcgtaagcgg
ccgctggagcagagcaactcggccctgagcgagagctctgccgccaccgagccctcctca
cctcagctcgggtcccccagttctgacagctgcccaggcctgagcaacggggaagaggtg
ggcccggagaagcccagcctggagcctcaaaagtctctgggcgaggacgggctaccgagg
ggccctgatgctcttgggtctgctgaccgtgaggacgaggaggaagaggaggaagaggag
gaacagacagatcctaaaaagccgaccacagatgagggcactgctagcagtgaggtcaat
gccaccgaggaaatgtcaacactcgtcaactacatcgagcctgtcaagttcaagtccttt
gaggctgctcgaaaaaggaacaaatgcttcgagatgtcatccttcgtggaaaccaaggcc
atggagcagctgaccaagagccccatggagtttgtggaatacaataagcagcagctcagc
cggatctaccccaagggcacccgcgtggactcgtccaactacatgccccagctcttctgg
aacgtcggctgccagcttgtcgcgctcaacttccagaccctggacgtggcgatgcagctc
aacgcgggcgtgttcgagtacaacgggcgcagcggctacctgctcaagcccgagttcatg
cggcggccagacaagtccttcgatcccttcaccgaggtcatcgtggacggcatcgtggcc
aatgccttgcgggtcaaggtgatctcggggcagttcctgtccgacaggaaggtgggcatc
tacgtggaggtggacatgttcggcctccccgtggacacgcggcgcaagtaccgcactcgg
acctctcaggggaactccttcaatcctgtgtgggacgaggagccctttgacttccccaag
gccctgcatgtgtcagggtcgggctcgggctcctggccctctgtagtcttcgagaagagg
acaagaagtttgagaccttttatttctctcgtagttgttccaacagccccatgtgataga
cgtggagcccaggccagaagggctgagggaagccggccgggggcactggggagccccggg
aggttagaaccagcatttctaggaaagagccttctgctttctccccgtcaggctcaggcc
ggcccagagacctgccaggagactcagtctcagcagctggggtcccagctgaccccaaac
cccacacccagccctcggggcacctccccgcgccggcccccaggccctgtcacgtcccct
accagcccctcgctcagcagtccagggcagcgggacgacctcatcgccagtctcctgtca
gaggtggccccgaccccgctggatgagctccgaggccacaaggcgctggtgaagctccgg
agccggcaggagagggggctacactcggtcccaccctctctgccagggtgccaggccgct
gttgaagtcccccacgaggagcgtgtatgtccagagactgttgcccctacaggctcccag
cgtttgcacggagcgaatgggcctcgttgttggcatcctagaccctgcccccacccctcc
cggggctggtgtcctccgttgcctgttgggatctgccctgtccgcccctgccctcccagc
ccaagtccatgtgacaaccagagagtcacccagaggggttcttcctacagaggcggggaa
aacgagaaggaggaggaggaagaggtgaggcggtatcaagagttccagaagagacaggtg
cagagtctgctggagctgagggaggcccaggtagatacagaggctgagcggaggctggag
cacctgagacaggctcagcagcggctcagggagattgtcctggattttcacacaactcag
ttcaagaggctgaaggagatgaacgagagggagaagaaggaactgcagaagattctggac
aggaagcgccacaacagtatctcagaggccaagacaagggagaaacataagaaggaggcg
gaactgacagagattaaccggcggcatatcaccgagtcggtcaactccatccgccggctg
gaggaggcccagaagcagcggcatgagcgccttgtggccgggcagcagcaggtcctacag
cagctggcagaagaggagcccaagctgctggcccagctggcccaggagtgtcaggagcag
cgggcgaggctgccccaggagatccgccggagcctgctgggcgacacgccggaggggctg
ggggacgggcgtctggtggcctgtgccagcaacggtcacgcacccgggagcggcgggcac
ctgtctggcgctgactcggagagccaagaggagaatacgaagctctga

DBGET integrated database retrieval system