KEGG   Ursus maritimus (polar bear): 103673623
Entry
103673623         CDS       T03271                                 

Gene name
CDH1
Definition
(RefSeq) cadherin 1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04015  Rap1 signaling pathway
umr04371  Apelin signaling pathway
umr04390  Hippo signaling pathway
umr04514  Cell adhesion molecules
umr04520  Adherens junction
umr05100  Bacterial invasion of epithelial cells
umr05200  Pathways in cancer
umr05213  Endometrial cancer
umr05216  Thyroid cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103673623 (CDH1)
   04390 Hippo signaling pathway
    103673623 (CDH1)
   04371 Apelin signaling pathway
    103673623 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103673623 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103673623 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103673623 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103673623 (CDH1)
   05216 Thyroid cancer
    103673623 (CDH1)
   05218 Melanoma
    103673623 (CDH1)
   05219 Bladder cancer
    103673623 (CDH1)
   05213 Endometrial cancer
    103673623 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103673623 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103673623 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:umr04515]
    103673623 (CDH1)
   04090 CD molecules [BR:umr04090]
    103673623 (CDH1)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103673623 (CDH1)
Cell adhesion molecules [BR:umr04515]
 Cadherins
  Major cadherins
   103673623 (CDH1)
CD molecules [BR:umr04090]
 Proteins
  103673623 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2 RET_CLD1 Cadherin_3 Big_9
Other DBs
NCBI-GeneID: 103673623
NCBI-ProteinID: XP_008700637
UniProt: A0A384D0M8
LinkDB
Position
Un
AA seq 881 aa
MGPRYPSVSAFLLLLQVSSWLCQEPEPCRPGFGADRYTFTVPRRHLERGRALGRVSFEGC
TGQPRTAYIADDTRFKVSTDGVVTVKRPLQLHKPEMSFLVHAWDSSRRKLSTRVTLKAAE
HHHHHRHDTLSETQTEVLTFPNSQRGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNR
DKEIKVFYSITGQGADTPPVGVFVIERETGWLKVTEPLDREQIAKYILYSHAVSSNGNAV
EDPMEIVITVTDQNDNKPEFTQEVFEGSVMEGALPGTSVMQVTATDADDDVNTYNAAIAY
RIVTQDPPLPSSMMFTINKDTGVISVLTTGLDRETIPTYTLVVEAADLQGEGLSTTATAV
ITVTDANDNPPVFKPTTYQGQVPENKADVEITILKVTDADVPNTPAWQAVYTILNNNNEQ
FVVTTDPVTNDGILKTAKGLDYEAKQQYVLYVTVVNVAPFEVILSTSTATVTVDVEDVNE
APVFKPCPKVVEIPEDFGVGQEITSYTAEDPDKYMEQRITYRIWRDAASWLEINPESGAI
FTRAELDREDIEHVKNSTYEAIIVAIDNGSPVATGTGTLLLILSDVNDNGPVPEPRSMDF
CQKNPQPRVININDPDLPPNTSPFTAELTHGASVNWTIEYNDQAHESLILKPKKTLELGD
YKINLKLTDNQNKDQVTTLDVFVCDCEGVVNSCKRTAPYAEAGLQVPAILGILGGILALL
ILILLLLLFVRRRGVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPE
VTRNDVAPTLLSVPQYRPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSE
AASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgggccctcggtaccctagtgtctccgcgttcctgctgctgctacaggtctcatcatgg
ctatgccaggagccggagccttgccgtcctggctttggcgctgacaggtacacgttcaca
gtgccccggcgacatttggagagaggccgagccctgggcagagtgagttttgaaggatgc
accggtcaaccaaggacagcctatattgcggacgacacgcgattcaaagtgagcacagac
ggtgtggtgaccgtcaagcggcctctacagcttcataaaccggagatgagttttctggtc
cacgcctgggactccagccgcaggaagctgtccaccagagtgacgctgaaggcagccgag
caccaccaccaccaccgtcatgacacgctctctgaaacccagacagaagtgctcacattt
cccaactcccagcgtggtctcagaagacagaagagagactgggttatccctcctatcagc
tgcccagaaaatgagaagggcccatttcctaaaaatctggttcagatcaaatctaacagg
gacaaagaaatcaaggttttctacagcatcactggccaaggagctgacacacctcctgtt
ggtgtgtttgttatcgaaagggaaacaggatggctgaaagtgacagagcctctggataga
gaacaaattgccaagtacattctctactctcacgccgtgtcttctaatgggaatgcagtt
gaagaccccatggagatcgtgatcacagtgacggatcagaatgacaacaagcctgagttc
acccaggaggtcttcgaaggatctgtcatggaaggtgctcttccaggcacctccgtgatg
caggtcacagccacagacgcggacgacgacgtgaacacctacaatgccgccatcgcttac
cgcatcgtcacccaagacccccccctgcctagcagcatgatgttcactatcaacaaggac
acgggagtcatcagcgtgctcaccaccgggctggaccgggagactattcccacgtacacc
ctggtggttgaggctgcagacctgcaaggtgaaggcttaagtacaactgcaacagctgtg
atcacggtcactgacgccaacgataacccccctgtcttcaaacccaccacgtaccagggg
caggtgcctgagaacaaggctgacgttgaaatcaccatactcaaagtaactgatgccgat
gtccccaataccccagcgtggcaggccgtgtacaccatattgaacaataacaatgagcaa
tttgtcgtcactacagacccagtaaccaacgacggcattttgaaaacagctaagggcttg
gattacgaggccaagcagcagtatgttctgtacgtgactgtggtgaacgtagccccgttt
gaggtcattctctccacctccacagccaccgtcactgtggacgtggaagatgtgaacgaa
gcccctgtctttaagccttgcccgaaggttgtggaaatacctgaagactttggggtgggc
caggaaatcacgtcctacactgccgaggatccggataagtatatggaacagaggataacg
tatcggatttggagggatgctgccagctggctggagattaatccagaatctggtgccatt
ttcactcgggctgagctggacagagaggacatagagcatgtgaagaacagcacgtatgag
gccatcattgtagccattgacaacggttccccagttgctactggaacaggaacccttctc
ctcatactctctgatgtgaatgacaatggccccgtaccagaacctcgaagtatggacttc
tgccagaagaatccacagcctcgtgtcatcaacatcaatgatccagatcttcccccaaac
acatctcccttcacagcagaactaacacacggggcaagtgtcaactggaccattgagtac
aatgaccaagcccatgaatctctaattttgaagccgaagaaaaccttagagttgggtgac
tacaaaataaatctcaagctcacggataatcagaacaaggaccaggtgaccaccctggat
gtgttcgtgtgcgactgcgaaggggtcgtcaacagctgtaagaggacggcgccttacgcc
gaagcaggcttgcaggttcctgccatcctgggcattcttggaggaatcctcgctttacta
atcctgatcctgctgcttctgctgtttgttcggaggagaggggtggtcaaagagccctta
ctacccccagaagatgacacccgggacaacgtttactactatgatgaagaaggaggtgga
gaagaggatcaggactttgacttgagccagttgcacaggggcctggatgctcggcctgaa
gtgactcgcaatgatgtggcgccaaccctcctgagtgtgccccagtatcggccccgccct
gccaatcccgatgaaattggaaacttcattgacgaaaacctgaaggcagcggacaccgac
cccaccgctcctccttacgactctctgctcgtgttcgactacgagggaagtggttctgaa
gctgctagtctgagctccttgaactcctcagagtcagaccaagaccaggactatgactac
ctgaacgaatggggcaatcgcttcaagaagctggcggacatgtacggaggtggcgaggac
gactag

KEGG   Ursus maritimus (polar bear): 103673974
Entry
103673974         CDS       T03271                                 

Definition
(RefSeq) cadherin-1-like
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04015  Rap1 signaling pathway
umr04371  Apelin signaling pathway
umr04390  Hippo signaling pathway
umr04514  Cell adhesion molecules
umr04520  Adherens junction
umr05100  Bacterial invasion of epithelial cells
umr05200  Pathways in cancer
umr05213  Endometrial cancer
umr05216  Thyroid cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103673974
   04390 Hippo signaling pathway
    103673974
   04371 Apelin signaling pathway
    103673974
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103673974
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103673974
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103673974
  09162 Cancer: specific types
   05226 Gastric cancer
    103673974
   05216 Thyroid cancer
    103673974
   05218 Melanoma
    103673974
   05219 Bladder cancer
    103673974
   05213 Endometrial cancer
    103673974
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103673974
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103673974
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:umr04515]
    103673974
   04090 CD molecules [BR:umr04090]
    103673974
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103673974
Cell adhesion molecules [BR:umr04515]
 Cadherins
  Major cadherins
   103673974
CD molecules [BR:umr04090]
 Proteins
  103673974
SSDB
Motif
Pfam: Cadherin RibLong Big_9
Other DBs
NCBI-GeneID: 103673974
NCBI-ProteinID: XP_008701044
UniProt: A0A384D2N1
LinkDB
Position
Un
AA seq 507 aa
MAGPTCFLLCMSATQGTPSGYQVEVLTFPHAHFGPRRQKRDWVIPXPENERGPYPKLVAQ
VKSNKDKEIRVFYRITGRGADEPPRGVFIMDRETGLLKVTMPLDREQEPHYVLLLRAVSS
TGNAVEDPMGTVIXLTDKNDNRPEFTQAVFEGSVMERALPGTSVMQITATDTDDQNTCNA
DIAYTIHSQDPSVPQSNMFAINRDTGVISVLAPGLDQQSTPAYTLTVQAADLGGEGLRAT
ATAVITVTQSNPNPPVFSPTWYVGQVFENTVDAGIVRLKVKDADVPGSPAWKAVFSILND
RAGLFTVTTDHETNDGLLKTAKDRKRVTSRGLCSLAGQPKGGLCAKSPKAVPTSTATVTV
DVMDVNEAPVFVPPIKMVEVPKDVGVGQEITSYRAQDPDSLQCQKIRYQIRHDPSHRLDI
NSETGVISXRASLHRDDMKNHTFSALVIATDDGQPPATGSGTLVLTLSDTDCPTVDSQCL
STCQRGPELPAVSMGHQDLSPKDYALT
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggccggccccacctgctttctgctctgcatgtctgccacccagggtactccctctgga
taccaggtggaggtgctgacgtttcctcatgcccacttcggtcccaggaggcaaaagaga
gactgggtgatcccantcccagagaatgaaagaggcccatacccaaaactcgtggcccag
gtcaaatctaacaaagacaaggaaatccgggttttctaccgcatcactggcagaggcgct
gatgagcctcctcgtggtgtgtttatcatggacagagaaacaggtttgctaaaggtgaca
atgcccctggacagagagcaggaaccccactatgttcttctccttcgtgctgtgtcttca
actgggaacgctgtggaggacccgatggggactgtgatcnngctgacagacaagaatgac
aacaggcccgaattcacccaggcggtctttgaggggtccgtgatggaaagagccctccca
ggaacatctgtgatgcaaatcacagcaacggacacggatgaccagaacacctgcaatgca
gacatcgcctacaccatccacagccaggacccctcggtacctcaatccaacatgttcgcc
atcaaccgggacacgggagtcatctctgtgctcgctcctgggctggaccaacagagcacc
cccgcatacaccctgacggtccaagctgccgacctcggaggcgaaggcttacgcgcgaca
gcaacagccgtgatcacagtcacccagagcaaccccaaccctcccgtcttcagccccact
tggtacgtgggccaggtgtttgagaacacggtggatgcagggatagtgaggctgaaggtg
aaggacgcagacgtccctggctcccccgcatggaaggctgtgttctccatcctgaacgac
agagcggggctcttcaccgtcaccacggaccacgagaccaatgacggccttctgaaaaca
gccaaggacaggaagagggtcacaagccggggcctgtgctctcttgcaggccagccaaag
gggggcctatgcgcaaagtccccgaaagctgtccccacgtccacagccaccgtcaccgtg
gatgtaatggacgtgaatgaggcccctgtcttcgtacccccgataaagatggtggaagtg
cccaaggatgttggtgtgggccaggaaataacatcttacagggcccaggacccagacagc
ctccaatgtcagaaaatcaggtaccagatacggcacgacccaagccatcggctggacatc
aactcagaaacaggtgtcatttccnaccgagccagtctgcacagggatgacatgaagaac
cacacattttcagcgcttgtcatagctacggacgatgggcaaccacctgccacgggcagc
gggacccttgtcctcactttgtctgacacagactgcccaacagtagactcacagtgcctt
tccacctgccagaggggaccagagctcccagctgtaagtatgggtcaccaggatctttca
ccaaaagattatgccctgacttga

DBGET integrated database retrieval system