KEGG   Ursus maritimus (polar bear): 103673987Help
Entry
103673987         CDS       T03271                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00010  Glycolysis / Gluconeogenesis
umr00030  Pentose phosphate pathway
umr00051  Fructose and mannose metabolism
umr00052  Galactose metabolism
umr01100  Metabolic pathways
umr01200  Carbon metabolism
umr01230  Biosynthesis of amino acids
umr03018  RNA degradation
umr04152  AMPK signaling pathway
umr05230  Central carbon metabolism in cancer
Module
umr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103673987 (PFKP)
   00030 Pentose phosphate pathway
    103673987 (PFKP)
   00051 Fructose and mannose metabolism
    103673987 (PFKP)
   00052 Galactose metabolism
    103673987 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103673987 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103673987 (PFKP)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    103673987 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:umr01009]
    103673987 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:umr03019]
    103673987 (PFKP)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103673987 (PFKP)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103673987 (PFKP)
Messenger RNA biogenesis [BR:umr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103673987 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103673987
NCBI-ProteinID: XP_008701060
UniProt: A0A384D2U3
LinkDB All DBs
Position
Un
AA seq 752 aa AA seqDB search
MNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGKNIVEANWESVSSILQVGGTIIGSARC
KAFRTREGRLKAAHNLVQRGITNLCVIGGDGSLTGANIFRKEXXXXXXXXXXXGELNEEQ
VEQHAHLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFLPESPPEEGWQENMCIKLSENRARKKRLNIIIVAEGAIDT
QNKPITSEQIKELVVKQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATP
ETPACVVSLSGNQAVRLPLVECVHMTQEVQKAMDERRFKDAVQLRGRSFESNLNTYKRLA
IKLPDDQIVKSNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHKMLAIYDGFEGFAKGQI
KEIGWGDVGGWTGQGGSILGTKRTLPGKSLEDIATQMRKHSINALLIIGGFEAYLGLLEL
SAAREKYEELCVPMVQVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQVCRRHLTEKMKTTIQRGLVLRN
ESCSENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWIS
TKLKEASGKGRRFMSDDSICVLGISKRNLLFRPVAQLRKETDFEHRIPKEQWWLKLRPLM
KILAKYEASYEVSDSHQLEPVHHRGHEEPAAI
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgctgtccgagctgtggtgcgcatgggaatctacgtgggggccaaagtgtac
tttatctatgagggttaccaaggcatggtcgatggcggcaaaaacattgtcgaagccaat
tgggagagcgtctccagcattctgcaagtgggagggaccattattggcagtgctcgttgc
aaagccttccgcactcgggaaggtcgcctgaaagctgctcataacttggttcagcggggc
atcaccaacctgtgtgtgatcggcggggacggaagtctcacaggggccaatatcttcagg
aaagagtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncaggcgagctcaacgaggagcag
gtggagcagcacgcgcacctcaacgtcgtgggcatggtgggctccatcgacaacgacttc
tgcgggaccgacatgaccatcggcaccgactccgccttgcacaggataatcgaggtcgtt
gacgccatcatgaccactgcccagagccaccagaggacctttgttctcgaggttatgggg
agacactgtgggtacctcgccctggtgagcgccttggcctgcggagcggactgggtgttc
cttccagaatccccaccagaagaaggctggcaggagaatatgtgcatcaagctctcagag
aaccgtgcccggaaaaaaagactgaatatcatcattgtggccgagggagccatagatacc
caaaataaacctattacctctgagcaaatcaaggagctcgtggtcaaacagctggggtac
gacacgcgggtgaccatccttggacacgtgcagagaggcgggactccttcggcctttgac
aggattttggccagtcgcatgggggtggaggccgtggttgcccttctccaggccaccccg
gagaccccggcctgcgtggtgtcgctgagcgggaaccaggccgtgcgcctgccgctggtg
gagtgcgtacatatgacccaggaagtgcagaaggccatggacgagaggagattcaaggac
gctgtgcagctccgcgggaggagcttcgagagcaatctgaacacttacaagcggctggcc
atcaagttgccggacgatcagatcgtgaagagcaactgtaacgtggccgtcataaacgtg
ggggcgcctgccgccgggatgaacgcagctgtgcgctcggccgtgcgtgtgggcatcgcg
gatgggcacaagatgctcgccatctacgacggctttgagggcttcgccaaaggccagata
aaggagatcggctggggggatgtcggaggttggaccggccaaggaggctccattctcggg
accaaacgcacgctgcctgggaagtcgttggaggacatcgccacacagatgcgaaagcac
agtatcaacgccctgctgatcattggtggatttgaggcctacctgggactgctggagctg
tcagctgcccgggagaagtacgaggagctctgtgtccctatggttcaggtccccgccacg
gtctccaacaatgtgccgggctccgatttcagcatcggcgcagacaccgccctgaacacc
atcaccgacacgtgtgaccgcatcaagcagtcggccagtgggaccaagcgccgtgtgttc
atcatcgagaccatggggggctactgtggctacctggccaacatgggggggctcgccgcc
ggagccgacgctgcctacattttcgaggagccgtttgatatccgagacctgcaggtatgt
cgacgccacctgacggagaagatgaagaccaccatccagaggggactcgtgctcaggaac
gagagctgcagcgagaactacaccacggacttcatctaccagctgtactccgaggagggc
aagggcgtgttcgactgcaggaagaacgtgctgggccacatgcagcagggtggagcacct
tccccgtttgacagaaactttggaaccaaaatctccgctagagccatgcagtggatcagc
acgaaactgaaggaggcttcgggcaaaggaagaagatttatgagcgatgattccatttgc
gtgctgggaataagcaaaagaaaccttcttttccggcctgtggcacagctgaggaaggaa
acagacttcgagcacaggatccccaaagagcagtggtggctgaagctgcggccgctcatg
aagatcctggccaagtacgaggccagctacgaggtctccgactcccaccagctggagccc
gtgcaccaccgaggccacgaggagcccgccgccatctag

DBGET integrated database retrieval system