KEGG   Ursus maritimus (polar bear): 103674238
Entry
103674238         CDS       T03271                                 

Gene name
EOGT
Definition
(RefSeq) EGF domain specific O-linked N-acetylglucosamine transferase
  KO
K18134  EGF domain-specific O-GlcNAc transferase [EC:2.4.1.255]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103674238 (EOGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103674238 (EOGT)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     103674238 (EOGT)
Glycosyltransferases [BR:umr01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   103674238 (EOGT)
SSDB
Motif
Pfam: DUF563
Other DBs
NCBI-GeneID: 103674238
NCBI-ProteinID: XP_008701345
UniProt: A0A384D2X8
LinkDB
Position
Un
AA seq 527 aa
MLKLLVLGVLLHGVSLSGHDEAPPKAEGIPGEPLFDYASIRLPEEHIPFFLHNNRHIATV
CKKDARCPYKKHLENLKYCWGYEKSCKPEFRFGYPVCTYVDVGWTDTLESAQDIFWKQAD
FGYAGERLEEMHVLCQPKETHDSSLVCSRYLQYCRAVNLYLDLRNIKRNHDRFKEDFLQS
GEIGGHCALDARALMSQGQRKSPLQSWFAELQSYTQLSFRPLEDAKCDIVIEKPAYFMKL
DAGVNMYHHFCDFINLYITQHVNNSFGTDVYIVMWDTSSYGYGDLFSDTWKAFTDYDVIH
LKTYDSKRVCFKEAVFSLLPRMRYGLFYNTPLISGCQNTGLFRAFSQHVLHRLNVTQEGP
KDGKIRVTILARSTEYRKILNQNELVNALKTVSTLEVQIVDYKYKELGFLDQLQITHNTD
IFIGMHGAGLTHLLFLPDWAAVFELYNCEDERCYLDLARLRGVHYVTWRRQNKVFPQDKG
HHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgttaaagctgcttgtccttggagtattgcttcatggtgtttccctgagtggccacgat
gaggctcctcccaaggccgagggcattccaggcgaacctctgtttgactatgccagtatc
cgcttgccggaggagcacattcccttctttttgcacaataataggcatattgccacggtc
tgtaagaaagatgcacgttgtccttataagaaacacctggagaatctaaaatactgctgg
ggttatgagaaatcctgcaaaccagagttcaggtttggctaccctgtctgcacctacgtc
gacgtgggatggacagatacccttgaatccgcccaagacatattctggaaacaagctgac
tttggatatgcgggcgagcggctggaggaaatgcatgtgctctgccagcctaaggaaacg
catgactcaagcctggtatgttcccgttatctgcaatactgcagagccgtcaatctctat
ctcgatttaagaaacatcaagagaaaccatgacagatttaaggaagattttctccagagt
ggtgaaatcggaggacactgtgcactggacgctcgggcgttgatgtctcaaggtcagcgc
aaaagccctctgcagtcttggtttgctgagctgcaaagctatacacagctcagcttcaga
cctctagaagatgctaaatgtgacattgtcattgagaaaccagcctacttcatgaaactg
gatgcaggtgttaacatgtatcaccacttctgtgactttatcaatctttacattactcag
cacgttaataattcattcggcacagatgtatacatcgtgatgtgggacaccagctcctac
ggatatggtgacctgttctcagacacctggaaagcgtttactgattatgatgttatacat
ttgaaaacttacgattccaagagggtatgttttaaagaagctgttttttccttactcccc
cggatgcgatatgggctcttctataatacccctttgatatccggctgtcaaaacacggga
ttattcagggcattttctcagcatgtgctacacagactgaatgtcacccaggaaggaccg
aaggatggaaaaatccgagtcaccatccttgcacggagcacagagtaccggaaaatacta
aaccaaaatgagctggtaaacgcactgaaaacagtatctacgcttgaggttcagattgtc
gattacaaatataaggaacttgggtttctggaccagctgcagatcactcataacacggac
atattcatcggcatgcacggagctgggcttacccacttacttttccttccagactgggcc
gctgtatttgaactgtacaactgtgaagacgagcgctgttacttagacctggccaggctg
agaggcgtccactacgtcacttggcgaaggcagaacaaagtctttcctcaggataagggc
caccacccaactctgggggaacatccgaaatttaccaactactcttttgatgtagaagaa
ttcatgtaccttgtccttcaggctgcagaccacgtattgcaacacccaaagtggcctttt
aagaaaaaacatgatgagctataa

KEGG   Ursus maritimus (polar bear): 103682584
Entry
103682584         CDS       T03271                                 

Gene name
OGT
Definition
(RefSeq) O-linked N-acetylglucosamine (GlcNAc) transferase
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
umr04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103682584 (OGT)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103682584 (OGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103682584 (OGT)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103682584 (OGT)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     103682584 (OGT)
Glycosyltransferases [BR:umr01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   103682584 (OGT)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     103682584 (OGT)
SSDB
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_8 TPR_17 TPR_12 TPR_14 TPR_16 TPR_19 TPR_7 TPR_10 TPR_6 TPR_9 NARP1 TPR_MalT TPR_15 FAT MIT TPR_21 Wzy_C_2 EST1_DNA_bind SNAP BTAD ANAPC3 Tcf25
Other DBs
NCBI-GeneID: 103682584
NCBI-ProteinID: XP_008710465
UniProt: A0A384DUA2
LinkDB
Position
Un
AA seq 1046 aa
MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLL
LSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKP
DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACY
LKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARI
FDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLA
NALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR
AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWT
DYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHK
PPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTN
FRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQA
MWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAV
IDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNGDSSNTALNMPVIPMN
TIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPED
AIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRI
IFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQL
TCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLY
LQMWEHYAAGNKPDHMIKPVEVTESA
NT seq 3141 nt   +upstreamnt  +downstreamnt
atggcgtcttccgtgggcaacgtggccgacagcacagaaccaacgaaacgtatgctttcc
ttccaagggttagctgagttggcacatcgagaatatcaggcaggagattttgaggcagct
gagagacactgcatgcagctctggagacaagagccagacaatactggtgtgcttttatta
ctttcatctatacacttccagtgtcgaaggctggacagatctgctcactttagcactctg
gcaattaaacagaacccccttctggcagaagcctattcgaacttggggaatgtgtacaag
gaaagagggcagttgcaggaagcaattgagcattaccggcatgcattgcgtctcaaacca
gatttcatcgatggttatattaacctggcagccgcattggtagcagcaggtgacatggaa
ggggcagtacaagcttacgtctctgctcttcagtacaatcctgatttgtactgtgttcgc
agtgacctggggaacctgctcaaagccctgggtcgcttggaagaagccaaggcatgttat
ttgaaagcaattgagacgcaaccgaactttgcagtagcttggagtaatcttggctgtgtt
ttcaatgcacaaggagagatttggcttgcaattcatcactttgagaaggctgtcaccctt
gaccccaattttctggatgcttatatcaatttaggaaatgtcttgaaagaggcacggata
tttgacagagctgtggcagcttatcttcgtgccctaagcttgagtccaaatcatgcagtg
gtgcacggcaacctggcttgtgtatactatgagcaaggcctgatagatctggcaatagac
acctacaggcgagctattgaactgcaaccacatttccctgatgcttactgcaacctagcc
aatgcactcaaagagaagggcagtgttgccgaagcagaagattgttataatacagctctc
cggctgtgtcccacccatgcagactctctgaataacctagccaatatcaaacgagaacag
ggaaacattgaagaggccgttcgcttatatcgtaaagcattggaagtcttcccagagttt
gctgctgctcattcaaatttagcaagtgtactgcagcagcagggaaaacttcaggaagct
ctgatgcattataaggaggctattcgaattagtcctacctttgccgatgcctactcgaac
atgggaaacactctgaaggagatgcaggatgttcagggagccttgcagtgttacactcgt
gccattcagattaaccctgcatttgcagatgcccacagcaatttggcttccattcataag
gattcagggaatattccagaagcaatagcttcttaccgcactgctctgaaactgaagcct
gattttcctgatgcttattgtaacttggctcattgcctgcagattgtctgtgattggaca
gactatgatgagcgaatgaagaagttggtcagtatcgtggctgaccagttagagaagaat
aggttgccttctgtgcatcctcatcatagtatgctatatcctctttctcatggcttcagg
aaggctattgctgagaggcatgggaacctctgcttggataagattaatgtccttcataag
ccaccatatgaacatccaaaagacttgaagcttagtgatggtcgactgcgtgtaggatat
gtgagttctgactttgggaatcatcctacttctcaccttatgcagtctattccaggcatg
cacaatcctgataaatttgaggtgttctgttacgccctgagcccagatgatggcacaaac
ttcagagtgaaagtgatggcagaagccaatcatttcattgatctctctcagattccctgc
aatgggaaagcagctgatcgcatccatcaggatggtatacacatccttgtaaatatgaat
ggttataccaagggtgctcgaaatgaactctttgctctcaggcctgctcctattcaggcg
atgtggctaggatacccggggaccagtggtgcgcttttcatggattatatcatcactgat
caggaaacttcaccagctgaagttgctgagcaatattccgagaaactggcttatatgccg
catactttctttattggtgatcatgctaatatgttccctcacttgaagaaaaaagcagtc
atcgattttaagtccaatggccacatctatgacaatcggattgttcttaatggcatcgac
ctcaaagcatttcttgatagtctgccggatgtgaaaattgtcaagatgaagtgtcctgat
ggaggagacaatggggacagcagtaatacagctcttaatatgcctgttattcctatgaat
actattgcagaagcagttatcgagatgattaacagagggcaaattcaaataacaattaat
ggattcagtattagcaatggactagcaactacccagatcaacaataaagctgccactgga
gaggaggttcctcgtactattatcgtaactacacgttctcagtatgggttaccagaagat
gccattgtgtactgtaattttaatcagttatacaaaattgacccttctactttgcagatg
tgggcaaacattctgaagcgtgttcccaatagtgtgctgtggctgttgcgttttccagca
gtaggagaacctaatattcaacagtatgcacaaaacatgggccttccccagaaccgtatc
atattttcacctgttgctcctaaagaggaacatgtcaggagaggccagctggctgatgtc
tgcctggacactcccctctgtaatggacacaccacagggatggatgtcctctgggcagga
acaccgatggtgactatgccaggagagactcttgcttctcgagttgcagcttcccagctc
acttgtttaggttgtcttgagcttattgctaaaaacagacaagaatatgaagacatagct
gtgaaactgggaactgacctagaatacctgaagaaaattcgtggcaaagtctggaagcag
agaatatctagccctctgttcaacaccaaacaatacacaatggaactagagcggctctat
ctacagatgtgggagcattatgcagctggcaacaaacctgatcacatgattaagcctgtt
gaagtcactgagtcggcctaa

DBGET integrated database retrieval system