KEGG   Ursus maritimus (polar bear): 103674247
Entry
103674247         CDS       T03271                                 

Gene name
MITF
Definition
(RefSeq) melanogenesis associated transcription factor
  KO
K09455  microphthalmia-associated transcription factor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04137  Mitophagy - animal
umr04380  Osteoclast differentiation
umr04916  Melanogenesis
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05218  Melanoma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103674247 (MITF)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103674247 (MITF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103674247 (MITF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674247 (MITF)
   05202 Transcriptional misregulation in cancer
    103674247 (MITF)
  09162 Cancer: specific types
   05218 Melanoma
    103674247 (MITF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103674247 (MITF)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    103674247 (MITF)
SSDB
Motif
Pfam: DUF3371 MITF_TFEB_C_3_N HLH Polysacc_deac_2
Other DBs
NCBI-GeneID: 103674247
NCBI-ProteinID: XP_008701358
UniProt: A0A384D2S5
LinkDB
Position
Un
AA seq 438 aa
MREQMQEQERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQTHL
ENPTKYHIQQAQRQQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGFYKFEEQNRAESE
CPTMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMANTLPVSGNLIDLYGNQ
GLPPPGLTISNSCPANLPNIKRELTACIFPTESEARALAKERQKKDNHNLIERRRRFNIN
DRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKELETRQKKLEHANRHL
LLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPTLENCGQDLLQHHADLPCTTTL
DLTDGTITFNNNLGAGTESNQAYSIPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGAS
KTSSRRSSMSMEEAEHAC
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcgtgagcaaatgcaggagcaggagcgcagggagcagcagcagaagctgcaggcggcc
cagttcatgcaacagagagtgcctgtgagtcagaccccagccataaacgtcagcgtgccc
accacccttccctctgccacccaggtgccgatggaagtccttaaggtgcagacccacctc
gaaaaccccaccaagtaccacatacagcaagcccaaaggcagcagcctggcgatcatgtc
atgccaccagtgccggggagcagcgcacccaacagccccatggctatgctcacacttaac
tccaactgtgaaaaagagggattttataagtttgaagagcaaaacagggcggaaagcgaa
tgcccaactatgaacacgcattcacgagcgtcgtgcatgcagatggatgatgtaatcgat
gacatcattagcctagaatcaagttataatgaagaaatcctgggattgatggatcctgct
ttgcaaatggcaaatacgttacctgtctctggaaatctgattgacctttatggcaaccaa
ggcctgccgcccccaggcctcaccatcagcaactcctgtccggccaaccttcccaacata
aaaagggagctcacagcgtgtatttttcccacagaatctgaagcgagagcattggctaaa
gagaggcaaaaaaaggacaatcacaacttgattgaacgaagaagacgatttaacataaat
gaccgcattaaagaactaggtactttgattcccaagtcaaatgatccagacatgcgctgg
aacaagggaaccatcttaaaagcatctgtggactatatccgaaagttgcaacgagaacag
caacgcgcaaaagaacttgaaacccgacagaagaaactggagcacgccaaccggcatttg
ttgctcagaatacaggaacttgaaatgcaggctcgagctcacggactttcacttattcca
tccacgggcctctgctcccccgatctggtgaatcggatcatcaagcaagaacccactctc
gagaactgcggccaagacctccttcagcatcacgcagacctaccgtgcacgacgacgctc
gatctcacagacggcaccatcaccttcaacaacaacctcggagccgggaccgagagtaac
caagcctatagcatccccacgaaaatgggatccaaactggaagacatcctgatggatgac
actctgtctcccgttggcgtaactgacccgctgctttcgtcagtgtcccccggagcttcc
aaaacgagcagccgaaggagcagcatgagcatggaagaggccgaacacgcttgttag

DBGET integrated database retrieval system