KEGG   Ursus maritimus (polar bear): 103674337
Entry
103674337         CDS       T03271                                 

Gene name
POFUT1
Definition
(RefSeq) protein O-fucosyltransferase 1
  KO
K03691  peptide-O-fucosyltransferase [EC:2.4.1.221]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103674337 (POFUT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103674337 (POFUT1)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.221  peptide-O-fucosyltransferase
     103674337 (POFUT1)
Glycosyltransferases [BR:umr01003]
 O-Glycan biosynthesis
  O-linked Fuc type
   103674337 (POFUT1)
SSDB
Motif
Pfam: O-FucT
Other DBs
NCBI-GeneID: 103674337
NCBI-ProteinID: XP_008701443
UniProt: A0A384D311
LinkDB
Position
Un
AA seq 411 aa
MSPDLILCCQLPWLSLVSWPSPPRPHILSKSCLPHALDAPGLTSTTVYHPGRFGNQADHF
LGSLAFAKLLNRTLAVPPWIEYQHHRPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEK
LAPTHWPPERRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFSGISFS
ASYKDQWIQRFSPKEHPVLALPGAPAQFPVLEEHRPLQKYMVWSDEMVRTGEAHIRTHLI
RPYVGIHLRIGSDWASCCLEPCPPTTPQKNACAMLKDGTAGSHFMASPQCVGSSRSTAAP
LTATMCLPDLKEIRRAVQLWVGALSARSVYIATDSESYAPEIQELFKGKVKVVSLKPEVA
QIDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMDKPPQLRDEF
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgagtccagacttgatcctatgctgccagctcccctggctctccttggtgtcctggccc
tccccaccccggccccacatcctttccaaatcctgcctgccccatgccctcgatgcccca
ggcctcacttcaaccaccgtataccatccagggcgcttcgggaaccaggctgatcacttc
ttgggctccctggcttttgcaaagctgttgaaccgcaccttggctgtacccccttggatt
gagtaccagcatcacaggcctcccttcaccaatctgcatgtgtcctaccagaagtacttc
aagctggagcccctccaggcctaccatcgagttatcagcctggaagacttcatggagaag
ctggcacccactcactggccccctgagaggcgagtggcttactgctttgaggtggcagcc
cagcgaagccctgataagaagacatgccccatgaaggaaggaaatccctttggcccattc
tgggatcagtttcatgtgagtttcaacaagtctgaacttttttccggcatttccttcagc
gcctcctacaaagaccagtggatccagagattttctccaaaggagcatccagtgctcgcc
ctgccaggagccccggcccagttccccgtcctggaggagcacaggccgctccagaagtac
atggtgtggtcagacgagatggtgaggacgggagaggcccacatccgcacccacctcatc
cggccctacgtgggcattcacctgcgcattggctccgactgggccagctgctgtcttgaa
ccctgtccccccacgaccccacagaagaacgcctgtgccatgctgaaggacgggacggcg
ggctcgcacttcatggcctccccgcagtgtgtgggctctagccgcagcacggccgcccct
ctcaccgcgacgatgtgcctgcctgacctgaaggagatcagacgggctgtgcagctctgg
gtgggcgcgctgagcgcccggtcggtctacatcgccacggactctgagagttatgcgcct
gagatccaagagctcttcaaagggaaggttaaggtggtgagcctgaagcctgaagtggcc
cagatcgacctatacatccttggccaagctgaccactttattggcaactgtgtctcctcc
ttcactgccttcgtgaagcgggaacgggacctccaggggaggccgtcttctttcttcggc
atggacaagccccctcagctgcgggatgagttctga

KEGG   Ursus maritimus (polar bear): 103680737
Entry
103680737         CDS       T03271                                 

Gene name
POFUT2
Definition
(RefSeq) protein O-fucosyltransferase 2
  KO
K03691  peptide-O-fucosyltransferase [EC:2.4.1.221]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    103680737 (POFUT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103680737 (POFUT2)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.221  peptide-O-fucosyltransferase
     103680737 (POFUT2)
Glycosyltransferases [BR:umr01003]
 O-Glycan biosynthesis
  O-linked Fuc type
   103680737 (POFUT2)
SSDB
Motif
Pfam: O-FucT
Other DBs
NCBI-GeneID: 103680737
NCBI-ProteinID: XP_008708442
UniProt: A0A384DMY8
LinkDB
Position
Un
AA seq 435 aa
MALLMGSVREGSPRNELAAPSSVNYQALENPESAPQAWGDLPSLSCPPTRYLLYDVNPPE
GFNLRRDVYIRVASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSDFFDLPSLN
RNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDPLLYAPDKHEY
YIGWFWGYEETRALNVSCLSVQGSASIMAPVLLRNTSARSVMLDRAENLLHDHYGGKEYW
NTRRSMVFARHLRAVGDEFRSRYLNSTDEADRIPFEEDWTKMKVTLGSSLGGPYLAVHLR
RKDFIWGHREDVPSLDGAVKKIRSLMKTHQLDKVFVATDAIRTEHETLKKLLPEMLRFEP
TWEELELYRDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPRTTYNRFCGD
REEACEQPTHWRVAY
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggccctcctcatgggctcggtgagggaggggtcgcctagaaacgagctggcagctccc
tcctcggtgaactaccaggccctggaaaaccccgagtctgcaccacaggcttggggggac
ctcccctcgctctcctgcccccccaccaggtaccttctgtatgacgtcaaccccccagag
ggcttcaacctccgcagggatgtctacattcgtgtggcctccctcctgaagacactgctg
aagaccgaggagtgggtgctggtgctgcccccgtggggccgcctctatcactggcagagc
cccgacattcaccaggtccggattccctggtccgacttttttgaccttccaagtctcaat
agaaacatcccggtcattgagtatgaacagttcattgcagagtccggcgggcccttcatc
gaccaggtttatgtcctgcaaagttacgcggaagggtggaaagaggggacctgggaagag
aaggtcgacgagcggccgtgcatcgacccgctgctgtacgccccggacaagcacgaatac
tacataggatggttttggggctacgaagaaaccagagctttaaacgtctcctgtttgtcc
gttcaaggatcggcttccatcatggcgcctgtgcttctgagaaacacgtcagcgaggtcg
gtgatgttggacagagccgagaaccttctgcatgaccactacggggggaaggagtactgg
aacacccggcggagtatggtgttcgccaggcacctgcgggccgtgggcgacgagttcaga
agcaggtacctgaactccacggacgaggccgacaggatcccctttgaggaggactggact
aagatgaaggtcacgctgggctcctccctggggggcccatacctcgcggtccacctgagg
agaaaagatttcatctggggccacagagaagacgtgcccagtctggacggggctgtgaag
aaaatccgcagcctcatgaagacccaccagctggacaaggtgttcgtggccacggacgcc
atcaggacggagcacgagacgctgaagaagctgttgccggagatgctgaggttcgagccc
acgtgggaggagctggagctgtacagggacggcggcgtggccatcattgaccagtggatc
tgcgcacatgccaggttcttcatcggtacctcggtctccacgttctctttccggatccac
gaggagagagagatcctcgggctcgacccccggacgacgtacaaccgcttctgcggggac
cgggaggaagcgtgcgagcagcccacgcactggagggtcgcctactga

DBGET integrated database retrieval system