Ursus maritimus (polar bear): 103674345 Help Entry 103674345         CDS       T03271                                  Gene name BCL2L1 Definition (RefSeq) BCL2 like 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism umr  Ursus maritimus (polar bear) Pathway umr01521   EGFR tyrosine kinase inhibitor resistance umr01524   Platinum drug resistance umr04014   Ras signaling pathway umr04064   NF-kappa B signaling pathway umr04115   p53 signaling pathway umr04137   Mitophagy - animal umr04140   Autophagy - animal umr04151   PI3K-Akt signaling pathway umr04210   Apoptosis umr04215   Apoptosis - multiple species umr04621   NOD-like receptor signaling pathway umr04630   JAK-STAT signaling pathway umr05012   Parkinson disease umr05014   Amyotrophic lateral sclerosis umr05022   Pathways of neurodegeneration - multiple diseases umr05145   Toxoplasmosis umr05162   Measles umr05166   Human T-cell leukemia virus 1 infection umr05168   Herpes simplex virus 1 infection umr05170   Human immunodeficiency virus 1 infection umr05200   Pathways in cancer umr05202   Transcriptional misregulation in cancer umr05212   Pancreatic cancer umr05220   Chronic myeloid leukemia umr05222   Small cell lung cancer umr05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103674345 (BCL2L1)    04630 JAK-STAT signaling pathway     103674345 (BCL2L1)    04064 NF-kappa B signaling pathway     103674345 (BCL2L1)    04151 PI3K-Akt signaling pathway     103674345 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103674345 (BCL2L1)    04137 Mitophagy - animal     103674345 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     103674345 (BCL2L1)    04215 Apoptosis - multiple species     103674345 (BCL2L1)    04115 p53 signaling pathway     103674345 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103674345 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103674345 (BCL2L1)    05202 Transcriptional misregulation in cancer     103674345 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     103674345 (BCL2L1)    05225 Hepatocellular carcinoma     103674345 (BCL2L1)    05220 Chronic myeloid leukemia     103674345 (BCL2L1)    05222 Small cell lung cancer     103674345 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     103674345 (BCL2L1)    05014 Amyotrophic lateral sclerosis     103674345 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     103674345 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103674345 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     103674345 (BCL2L1)    05162 Measles     103674345 (BCL2L1)    05168 Herpes simplex virus 1 infection     103674345 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103674345 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103674345 (BCL2L1)    01524 Platinum drug resistance     103674345 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:umr01009]     103674345 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:umr03036]     103674345 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:umr02000]     103674345 (BCL2L1) Protein phosphatases and associated proteins [BR:umr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      103674345 (BCL2L1) Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     103674345 (BCL2L1) Transporters [BR:umr02000]  Other transporters   Pores ion channels [TC:1]    103674345 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  103674345 NCBI-ProteinID:  XP_008701458 UniProt:  A0A384D3U1 LinkDB All DBs Position Un AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaagga actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcagtgaagcaagcgctgagggaggccggggatgagttcgaactgagg taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcgtat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcattgtgcgtggagagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagcg gctgaaagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system