KEGG   Ursus maritimus (polar bear): 103674345
Entry
103674345         CDS       T03271                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01524  Platinum drug resistance
umr04014  Ras signaling pathway
umr04064  NF-kappa B signaling pathway
umr04115  p53 signaling pathway
umr04137  Mitophagy - animal
umr04140  Autophagy - animal
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr04621  NOD-like receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr05012  Parkinson disease
umr05014  Amyotrophic lateral sclerosis
umr05022  Pathways of neurodegeneration - multiple diseases
umr05145  Toxoplasmosis
umr05162  Measles
umr05166  Human T-cell leukemia virus 1 infection
umr05168  Herpes simplex virus 1 infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05212  Pancreatic cancer
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103674345 (BCL2L1)
   04630 JAK-STAT signaling pathway
    103674345 (BCL2L1)
   04064 NF-kappa B signaling pathway
    103674345 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    103674345 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103674345 (BCL2L1)
   04137 Mitophagy - animal
    103674345 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    103674345 (BCL2L1)
   04215 Apoptosis - multiple species
    103674345 (BCL2L1)
   04115 p53 signaling pathway
    103674345 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103674345 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674345 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    103674345 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103674345 (BCL2L1)
   05225 Hepatocellular carcinoma
    103674345 (BCL2L1)
   05220 Chronic myeloid leukemia
    103674345 (BCL2L1)
   05222 Small cell lung cancer
    103674345 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103674345 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    103674345 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    103674345 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103674345 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    103674345 (BCL2L1)
   05162 Measles
    103674345 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    103674345 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103674345 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103674345 (BCL2L1)
   01524 Platinum drug resistance
    103674345 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:umr01009]
    103674345 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103674345 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:umr02000]
    103674345 (BCL2L1)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103674345 (BCL2L1)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103674345 (BCL2L1)
Transporters [BR:umr02000]
 Other transporters
  Pores ion channels [TC:1]
   103674345 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 103674345
NCBI-ProteinID: XP_008701458
UniProt: A0A384D3U1
LinkDB
Position
Un
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaagga
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcagtgaagcaagcgctgagggaggccggggatgagttcgaactgagg
taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcgtat
cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcattgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct
tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagcg
gctgaaagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system