KEGG   Ursus maritimus (polar bear): 103674465
Entry
103674465         CDS       T03271                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103674465 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:umr04030]
    103674465 (PTGDR)
G protein-coupled receptors [BR:umr04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    103674465 (PTGDR)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 103674465
NCBI-ProteinID: XP_008701608
UniProt: A0A384D3H9
LinkDB
Position
Un
AA seq 211 aa
LVCCLTVTDLLGKSLVSPFVLAAYAQNRSLWGLEPASGSSLCQAFAFFMSFFGLASTLQL
LAMALECWLSLGHPFFYRRHITLRRGALVAPVVGAFCLAFCALPFAGFGKFVQYCPGTWC
FIQMVHEERSMSYRAYYGAFKTVHEKDGTSEEMEDLRALRFLSVISIVDPWIFIIFRTPV
FRMFFHKIFIRPLMYRNCPNNSCRTNMESSL
NT seq 636 nt   +upstreamnt  +downstreamnt
ctagtgtgctgcctgacggtcacagacttgctgggcaaatccctcgtgagccccttcgtg
ctcgccgcctacgcgcaaaaccggagcctgtggggactggagcccgcgtcgggcagctcg
ctgtgccaagccttcgccttcttcatgtccttctttgggctcgcctcgacgctgcagctc
ctggccatggccctggagtgctggctgtccttggggcacccctttttctaccgacggcac
atcaccctgcgccgcggcgcgctcgtggctccggtcgtgggcgccttctgcctggctttc
tgcgcgctgcccttcgcgggcttcgggaagttcgtgcagtactgtcctggcacctggtgc
ttcatccagatggtgcacgaggagcgctcaatgtcgtatcgtgcttactatggagcattt
aaaaccgtccatgagaaagatggaacctctgaagaaatggaagacctccgagccttgcgt
tttctgtctgtaatttccattgtggacccttggattttcataattttcagaacaccagta
tttcggatgttttttcacaagattttcataaggcctcttatgtacagaaattgtcccaac
aattcctgtcgaactaacatggagtccagtctgtga

DBGET integrated database retrieval system