KEGG   Ursus maritimus (polar bear): 103674676
Entry
103674676         CDS       T03271                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103674676
SSDB
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 103674676
NCBI-ProteinID: XP_008701812
UniProt: A0A384D416
LinkDB
Position
Un
AA seq 152 aa
MRCLASLTLALLALEAALALAPAPALTLPGQAMCPELSSSEEDACTVSCNSDESCPRGTK
CCPRSPCSRSCMVPFIAPAQKAGRCPHVQAPLISAPCLESNECSRDDQCADNRKCCLSAC
AMRCLEPEAGERPTPSPDSAPASATDAAEGLG
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcgctgtctcgccagcctaactctggccctgctggccctggaggccgccctggccctg
gccccggccccagccctcactctgccagggcaggccatgtgcccggagctcagctcctcg
gaggaggatgcctgcacggtctcctgcaactcggatgagagctgcccccgaggcaccaaa
tgctgccccaggagcccctgcagccgctcctgcatggtccctttcatcgctcccgcgcag
aaggcaggccgctgcccccacgtgcaggccccgctgatctcagcaccctgtttggagagc
aacgagtgttccagagacgaccagtgtgcggacaacaggaagtgctgcctcagcgcctgt
gccatgcggtgtctggagcccgaggcaggtgagcgccccacaccctccccggacagcgcc
ccggcctcggccaccgatgcagcagaaggtctgggctga

DBGET integrated database retrieval system