KEGG   Ursus maritimus (polar bear): 103674796
Entry
103674796         CDS       T03271                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04014  Ras signaling pathway
umr04390  Hippo signaling pathway
umr04392  Hippo signaling pathway - multiple species
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05219  Bladder cancer
umr05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103674796 (RASSF1)
   04390 Hippo signaling pathway
    103674796 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    103674796 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674796 (RASSF1)
   05206 MicroRNAs in cancer
    103674796 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    103674796 (RASSF1)
   05223 Non-small cell lung cancer
    103674796 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF5111 Mst1_SARAH
Other DBs
NCBI-GeneID: 103674796
NCBI-ProteinID: XP_008701966
UniProt: A0A384D4R6
LinkDB
Position
Un
AA seq 298 aa
MSKDWDIAVFPRRNKVDTEMKYRTIWVCVRSKEKRGIKGDLDCKFTCHYRCRALVCLDCC
GPRDLGWEPALELDTNVDEPVEWETPDLSQAEVEQKIKEYNSQINSNLFMSLNKDGSYTG
FIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRA
REVIEALLRKFLVVDDPRKFALFERAERHSQVYLRKLSDDEQPLRLRLLAGPSEKALSFV
LKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 897 nt   +upstreamnt  +downstreamnt
atgagcaaggactgggacattgcagtgttcccaaggagaaataaagtggacacagagatg
aaatacaggacaatttgggtgtgtgtcagaagcaaagagaagagaggaatcaagggtgat
ttggattgcaagttcacatgccactaccgttgccgcgcccttgtctgcctggactgctgc
gggccccgggacctgggctgggaacctgcgctggagctggacacaaacgtggacgagcct
gtggagtgggagacacctgacctttctcaggctgaggttgaacagaagatcaaggagtac
aatagccagatcaacagcaacctcttcatgagcctgaacaaggatggctcctacacaggc
ttcatcaaagttcagctgaagctggtgcgtcctgtctcagtgccttccagcaagaagcca
ccctccttgcaggatgccaggcggggcccagggcggggcacagctgtgaagcgccggacc
tccttctacctgcccaaggatgctgtcaagcacctgcatgtgttgtcacgcacgcgggca
cgtgaggtcattgaggccctacttcgcaaattcttggtggtggacgacccccgcaagttt
gcactctttgagcgggctgaacgccatagccaagtgtacctccggaagctgtcggatgat
gagcagcccctgcggctgcgactccttgcagggcccagcgagaaggccctaagctttgtc
ctcaaggagaatgactctggggaggtgaattgggatgcctttagcatgcctgaactacac
aacttcctgcgcatcctacaacgggaggaagaggaacacctccgccagatcctgcaaaag
tactcctattgccgtcagaagatccaggaggccctgcacgcctgccccctggggtga

DBGET integrated database retrieval system