Ursus maritimus (polar bear): 103674825 Help Entry 103674825         CDS       T03271                                  Gene name RHOA Definition (RefSeq) ras homolog family member A   KO K04513   Ras homolog gene family, member A Organism umr  Ursus maritimus (polar bear) Pathway umr04014   Ras signaling pathway umr04015   Rap1 signaling pathway umr04022   cGMP-PKG signaling pathway umr04024   cAMP signaling pathway umr04062   Chemokine signaling pathway umr04071   Sphingolipid signaling pathway umr04072   Phospholipase D signaling pathway umr04144   Endocytosis umr04150   mTOR signaling pathway umr04270   Vascular smooth muscle contraction umr04310   Wnt signaling pathway umr04350   TGF-beta signaling pathway umr04360   Axon guidance umr04510   Focal adhesion umr04520   Adherens junction umr04530   Tight junction umr04611   Platelet activation umr04621   NOD-like receptor signaling pathway umr04625   C-type lectin receptor signaling pathway umr04660   T cell receptor signaling pathway umr04670   Leukocyte transendothelial migration umr04722   Neurotrophin signaling pathway umr04810   Regulation of actin cytoskeleton umr04921   Oxytocin signaling pathway umr04928   Parathyroid hormone synthesis, secretion and action umr04972   Pancreatic secretion umr05100   Bacterial invasion of epithelial cells umr05132   Salmonella infection umr05133   Pertussis umr05135   Yersinia infection umr05152   Tuberculosis umr05163   Human cytomegalovirus infection umr05200   Pathways in cancer umr05203   Viral carcinogenesis umr05205   Proteoglycans in cancer umr05206   MicroRNAs in cancer umr05210   Colorectal cancer umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103674825 (RHOA)    04015 Rap1 signaling pathway     103674825 (RHOA)    04310 Wnt signaling pathway     103674825 (RHOA)    04350 TGF-beta signaling pathway     103674825 (RHOA)    04072 Phospholipase D signaling pathway     103674825 (RHOA)    04071 Sphingolipid signaling pathway     103674825 (RHOA)    04024 cAMP signaling pathway     103674825 (RHOA)    04022 cGMP-PKG signaling pathway     103674825 (RHOA)    04150 mTOR signaling pathway     103674825 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103674825 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103674825 (RHOA)    04520 Adherens junction     103674825 (RHOA)    04530 Tight junction     103674825 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103674825 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103674825 (RHOA)    04621 NOD-like receptor signaling pathway     103674825 (RHOA)    04625 C-type lectin receptor signaling pathway     103674825 (RHOA)    04660 T cell receptor signaling pathway     103674825 (RHOA)    04670 Leukocyte transendothelial migration     103674825 (RHOA)    04062 Chemokine signaling pathway     103674825 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     103674825 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     103674825 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103674825 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     103674825 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     103674825 (RHOA)   09158 Development and regeneration    04360 Axon guidance     103674825 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103674825 (RHOA)    05206 MicroRNAs in cancer     103674825 (RHOA)    05205 Proteoglycans in cancer     103674825 (RHOA)    05203 Viral carcinogenesis     103674825 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     103674825 (RHOA)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103674825 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     103674825 (RHOA)    05135 Yersinia infection     103674825 (RHOA)    05133 Pertussis     103674825 (RHOA)    05152 Tuberculosis     103674825 (RHOA)    05100 Bacterial invasion of epithelial cells     103674825 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     103674825 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103674825 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103674825 (RHOA)    04031 GTP-binding proteins [BR:umr04031]     103674825 (RHOA) Membrane trafficking [BR:umr04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103674825 (RHOA) Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103674825 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    103674825 (RHOA)   Exosomal proteins of colorectal cancer cells    103674825 (RHOA)   Exosomal proteins of bladder cancer cells    103674825 (RHOA) GTP-binding proteins [BR:umr04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103674825 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  103674825 NCBI-ProteinID:  XP_008702012 UniProt:  A0A384D4K7 LinkDB All DBs Position Un AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatgggaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggacc ccggaagtcaagcacttctgtcccaacgtacccatcatcctggttgggaacaagaaggac cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtgaaa ccggaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system