KEGG   Ursus maritimus (polar bear): 103674825
Entry
103674825         CDS       T03271                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04144  Endocytosis
umr04150  mTOR signaling pathway
umr04270  Vascular smooth muscle contraction
umr04310  Wnt signaling pathway
umr04350  TGF-beta signaling pathway
umr04360  Axon guidance
umr04510  Focal adhesion
umr04520  Adherens junction
umr04530  Tight junction
umr04611  Platelet activation
umr04621  NOD-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04660  T cell receptor signaling pathway
umr04670  Leukocyte transendothelial migration
umr04722  Neurotrophin signaling pathway
umr04810  Regulation of actin cytoskeleton
umr04921  Oxytocin signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04972  Pancreatic secretion
umr05100  Bacterial invasion of epithelial cells
umr05132  Salmonella infection
umr05133  Pertussis
umr05135  Yersinia infection
umr05152  Tuberculosis
umr05163  Human cytomegalovirus infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103674825 (RHOA)
   04015 Rap1 signaling pathway
    103674825 (RHOA)
   04310 Wnt signaling pathway
    103674825 (RHOA)
   04350 TGF-beta signaling pathway
    103674825 (RHOA)
   04072 Phospholipase D signaling pathway
    103674825 (RHOA)
   04071 Sphingolipid signaling pathway
    103674825 (RHOA)
   04024 cAMP signaling pathway
    103674825 (RHOA)
   04022 cGMP-PKG signaling pathway
    103674825 (RHOA)
   04150 mTOR signaling pathway
    103674825 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103674825 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103674825 (RHOA)
   04520 Adherens junction
    103674825 (RHOA)
   04530 Tight junction
    103674825 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103674825 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103674825 (RHOA)
   04621 NOD-like receptor signaling pathway
    103674825 (RHOA)
   04625 C-type lectin receptor signaling pathway
    103674825 (RHOA)
   04660 T cell receptor signaling pathway
    103674825 (RHOA)
   04670 Leukocyte transendothelial migration
    103674825 (RHOA)
   04062 Chemokine signaling pathway
    103674825 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103674825 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    103674825 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103674825 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    103674825 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103674825 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    103674825 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674825 (RHOA)
   05206 MicroRNAs in cancer
    103674825 (RHOA)
   05205 Proteoglycans in cancer
    103674825 (RHOA)
   05203 Viral carcinogenesis
    103674825 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103674825 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103674825 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103674825 (RHOA)
   05135 Yersinia infection
    103674825 (RHOA)
   05133 Pertussis
    103674825 (RHOA)
   05152 Tuberculosis
    103674825 (RHOA)
   05100 Bacterial invasion of epithelial cells
    103674825 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103674825 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103674825 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103674825 (RHOA)
   04031 GTP-binding proteins [BR:umr04031]
    103674825 (RHOA)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    103674825 (RHOA)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103674825 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   103674825 (RHOA)
  Exosomal proteins of colorectal cancer cells
   103674825 (RHOA)
  Exosomal proteins of bladder cancer cells
   103674825 (RHOA)
GTP-binding proteins [BR:umr04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    103674825 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 103674825
NCBI-ProteinID: XP_008702012
UniProt: A0A384D4K7
LinkDB
Position
Un
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt
ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag
aactatgtggcagatattgaagttgatgggaagcaggtagagttggctttgtgggataca
gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggacc
ccggaagtcaagcacttctgtcccaacgtacccatcatcctggttgggaacaagaaggac
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtgaaa
ccggaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system