KEGG   Ursus maritimus (polar bear): 103675060
Entry
103675060         CDS       T03271                                 

Gene name
APPL1
Definition
(RefSeq) adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1
  KO
K08733  DCC-interacting protein 13 alpha
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04211  Longevity regulating pathway
umr05200  Pathways in cancer
umr05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    103675060 (APPL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103675060 (APPL1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103675060 (APPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103675060 (APPL1)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103675060 (APPL1)
SSDB
Motif
Pfam: BAR_3 PID PH PTB BAR PH_9 Med26_C
Other DBs
NCBI-GeneID: 103675060
NCBI-ProteinID: XP_008702311
UniProt: A0A384D5R9
LinkDB
Position
Un
AA seq 706 aa
MSDMEIDAPHTVDDLFTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTS
KLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERD
LKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYF
CALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLTNIGTSVQNVRREMDN
DVETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQFY
FTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKD
HEEWICTINNISKQIYLSENPEEIAARVNQSALEAVTPSPSFQQRHESLRPAAQSRPPTA
RTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFG
ESGGGTKSETEDSILHQLFIVRFLGSMEVKSDDNPDVVYETMRQILAARAIHNIFRMTES
HLLVSCDCLKLIDPQTQVTRLTFPLPSVVLYATHQENKRLFGFVLRTSGGRSESNLSSVC
YIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELSKQKQIEKDL
EEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEEGKKRESEA
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgtctgatatggagattgatgccccccatacagttgatgatttatttacaaggtcttta
ctgggtgtatttgaagaagatgctacagctatttccaactatatgaaccagttgtatcaa
gctatgcatcggatttatgacgcacagaatgaattaagtgcagcaacacacctgacttca
aaacttttaaaggaatatgaaaaacagcgttttccattggggggcgatgatgaagttatg
agctctactttgcaacagttttcaaaagttatagatgagcttagctcttgtcatgcagta
ctttcaactcagcttgctgatgccatgatgtttcccattactcagtttaaagaaagagat
ctaaaagaaatactgacattaaaggaagtgtttcagattgctagtaatgatcatgatgct
gcaattaacagatatagcaggttgtcaaaaaaaagagaaaatgacaaggtaaagtatgaa
gtaacggaagatgtctacacttccagaaaaaaacaacaccagaccatgatgcattatttt
tgtgccttaaatactcttcaatacaaaaagaaaatagcattgttagaacctctgcttggg
tacatgcaagctcagataagtttctttaagatgggttctgaaaatctcaatgaacagctg
gaagaattcttgactaatattggaacaagtgtacaaaacgttcgtagggaaatggacaat
gatgtagagaccatgcagcagacaatagaagatttggaagtggccagtgaccccttatat
gtgcctgacccagatcccacgaaatttcctgttaatcgaaacttaacccggaaggctgga
taccttaatgctaggaataaaacaggcttggtgtcatctacctgggacagacagttttac
ttcacgcaggggggaaacttaatgagtcaggcgcgtggggatgtggcaggcggcctggcc
atggacattgacaactgttcagtaatggctgtggactgtgaagacaggcggtactgtttt
cagatcacttcctttgatggaaaaaaatcttcaattttgcaagcagaaagtaaaaaagac
catgaggagtggatctgtacaataaataacatatccaaacaaatatatttaagtgaaaac
ccagaggaaattgctgcacgagtaaatcagtcagctttggaagcggtcactccttcccca
tctttccagcagaggcatgagagtctgcggccggcagcacaatctcggccaccaacagct
cgaaccagcagctcgggatccttaggatcggagtccacgaatttggctgccctttctctg
gactctctcgttgctccagacactccgatacagtttgacatcatttctcctgtgtgtgaa
gatcagcctggtcaggcaaaagcctttggccagggaggcaggcgcacaaatccatttgga
gaatctggaggaggtacaaaatctgaaactgaagattctattcttcatcagttatttatt
gtccgattccttggttctatggaggtgaaatcagatgacaatccagatgttgtttatgaa
acaatgaggcaaatcctagctgcccgggccatccataacatctttcgtatgacagaatca
catttattagtctcttgtgattgtttaaagttaattgatccacagacacaagttacaagg
ctcacatttccattacccagtgtagttttgtacgctacacaccaggaaaataagaggctt
tttggatttgttcttcggacatcaggagggagaagtgaaagtaatctgtcatcagtctgc
tatatatttgaatcaaacaatgagggagaaaagatttgtgattctgttggtctggcaaaa
caaatagctttgcatgcagaactggatcgtcgggcatcagaaaaacaaaaagaaatagaa
agggtaaaagagaagcaacaaaaagaactcagtaaacaaaaacaaattgagaaggactta
gaagaacaaagtcgcttgatagctgcttccagtagaccaaaccaagccagtagtgagggg
cagtttgttgtccttagcagtagccagtcagaagagagtgatttgggagaagaaggaaag
aaaagagagtcagaagcatga

DBGET integrated database retrieval system