KEGG   Ursus maritimus (polar bear): 103675520Help
Entry
103675520         CDS       T03271                                 

Gene name
CSAD
Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00430  Taurine and hypotaurine metabolism
umr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 Metabolism
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    103675520 (CSAD)
Enzymes [BR:umr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     103675520 (CSAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DUF4910 DegT_DnrJ_EryC1 SepSecS Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 103675520
NCBI-ProteinID: XP_008702847
LinkDB All DBs
Position
Un
AA seq 508 aa AA seqDB search
MNTDFWSMQIKYFVLMADSKPVFSLDGDPMAAEALLRDVFGIVVDEVIRKGTSASEKVCE
WKEPEELKQLLDLELRSQGEASEQILARCREVIRYSVKTCHPHFFNQLFSGLDPHALAGR
IVTESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWSSGDGVFCPGGSISNMYAVNLARY
QRYPDCKQRGLRALPPLALFTSKECHYSIKKGAAFLGLGTDSVRVVKTDERGKMIPEDLE
RLISLAEAEGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQT
HRHLLDGIQRADSVAWNPHKLLTAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDV
ALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRVNQAFALAWYLVEELKKREGFELVM
EPEFVNVCFWFVPPSLRGKKESPDYGERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFF
RMVVANPALTRADMDFLLDELERLGQDL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagatttttggtccatgcaaatcaaatattttgtcctgatggctgactctaaa
ccagtcttctcccttgatggggaccccatggctgcagaagccttgctccgggatgtgttt
gggattgttgtggatgaggtcattcggaaagggaccagtgcctccgagaaggtgtgcgag
tggaaggagcccgaggagctgaagcagctgctggacctggagctgcgcagccagggcgag
gcatcggagcagatcctggcgcgctgccgggaggtgatccgctatagcgtgaagacctgt
catccgcacttcttcaaccagctcttctcagggttggatccgcacgctctggcggggcgc
attgtcactgagagcctcaacaccagccagtacacttatgaaatcgcccccgtatttgtg
ctcatggaagaagaggtgctgaagaaactccgggccctggtgggctggagctctggggat
ggggtcttctgccctggtggttccatctccaacatgtatgccgtgaacctggcccgctat
cagcgctacccggattgcaagcagaggggcctccgggcgctgccgcccctggcactcttt
acatcaaaggagtgtcattactccatcaagaagggagctgcttttctgggacttggcacc
gacagtgtccgagtagtcaagacagatgagagagggaaaatgattcctgaggatctggaa
aggctgatcagtctggccgaggctgagggtgctgtgccgttcctggttagtgccacgtct
ggcactaccgtgctgggggcctttgacccactggaggccattgctgacgtgtgccagcgt
cacggactgtggctccatgtggatgccgcctggggtgggagcgtcctgttgtcacagaca
cacagacatctcctggatgggatccagagggctgactccgtggcctggaatcctcacaag
cttctcaccgcaggcctgcagtgctcggctcttcttctccgggatacctcgaacctgctt
aagcgctgccacgggtcccaggccagctacctcttccagcaggacaagttctatgatgtg
gctctggacactggagacaaggtggtgcagtgtggccgccgcgtggactgtctgaagctg
tggctcatgtggaaggcacagggcgggcaagggctggagcggcgtgtcaaccaggccttt
gcccttgcctggtacctggtggaggaattgaagaagcgagaaggatttgagttggtcatg
gagcctgagtttgtcaatgtgtgtttctggttcgtgccccccagcctgcgggggaagaaa
gagagcccagattacggtgaaaggctgtctaaggtggccccggtgctcaaggagcgcatg
gtaaaggagggctccatgatgatcggctaccagccccatgggacccggggcaactttttc
cgcatggttgtggccaaccccgcgctgacccgggctgatatggatttccttctcgacgag
ctggaaaggctaggccaggacctctga

DBGET integrated database retrieval system