KEGG   Ursus maritimus (polar bear): 103675530
Entry
103675530         CDS       T03271                                 

Gene name
SP1
Definition
(RefSeq) Sp1 transcription factor
  KO
K04684  transcription factor Sp1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04137  Mitophagy - animal
umr04350  TGF-beta signaling pathway
umr04915  Estrogen signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr05016  Huntington disease
umr05017  Spinocerebellar ataxia
umr05163  Human cytomegalovirus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05224  Breast cancer
umr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103675530 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103675530 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103675530 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    103675530 (SP1)
   04927 Cortisol synthesis and secretion
    103675530 (SP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103675530 (SP1)
   05202 Transcriptional misregulation in cancer
    103675530 (SP1)
   05231 Choline metabolism in cancer
    103675530 (SP1)
  09162 Cancer: specific types
   05224 Breast cancer
    103675530 (SP1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103675530 (SP1)
   05017 Spinocerebellar ataxia
    103675530 (SP1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103675530 (SP1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103675530 (SP1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103675530 (SP1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    103675530 (SP1)
Mitochondrial biogenesis [BR:umr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    103675530 (SP1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 103675530
NCBI-ProteinID: XP_008702863
UniProt: A0A384D730
LinkDB
Position
Un
AA seq 780 aa
MDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSGGGGQESQPSPLALLAATC
SRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSST
NGSNGSESSKNRTVSGGQYVVAATSNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQ
FAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSG
QTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPATSGTAISSA
SLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSAGTNSQGQTAQRVSGLQGSDAL
NIQQNQTSGGSLQASQQKEGEQNQQTQQQQQQQILIQPQLVQGGQALQALQAAPLSGQTF
TTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLA
PMQGVSLGQTSSSNTTLTPIASAASIPTGTVTVNAAQLSSMPGLQTINLSALGASGIQVH
QLPSLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDPQPQAGRRTRREACT
CPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGK
RFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVSLSVGTLP
LDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggatgaaatgacagccgtggtgaagattgaaaaaggagttggtggcaataatgggggc
aatggtaatggtggtggtgccttttctcaggcacgaagcagcagcacaggcagtagcagc
agtggaggaggagggcaggaatcccagccatcccctctggctctgctggcagcaacttgc
agcagaattgagtcacccaatgaaaacagcaacaactcccagggcccaagccagtcaggg
ggcacaggtgagcttgacctcacagccacacagctctcacagggtgccaatggctggcag
atcatctcttcctcctctggggctacccctacctcaaaggaacagagtggcagcagtacc
aatggcagcaatggcagtgagtcttccaagaatcgcacggtctctggtgggcagtatgtt
gtggctgccacctccaatttacagaaccagcaagttctgaccggattacctggagtgatg
cctaatattcagtatcaggtaatcccacagttccagaccgttgatgggcaacaactgcag
ttcgcagccaccggggcccaagtgcagcaggatggttctggtcagatacagatcatacca
ggtgcaaaccaacagatcataacaaatcgaggaagtggaggcaacatcattgctgctatg
ccaaacctactccagcaggctgtccccctccaaggcctggctaataacgtactctcagga
cagactcagtatgtgaccaatgtaccagtggccctgaatgggaatatcaccttgctacct
gtcaacagcgtttctgcagctaccttgactcctagctctcaggcagtcactatcagcagc
tctgggtcccaggagagtggctcacagcccgccacctcggggactgccatcagttctgcc
agtttggtatcatcacaagccagttccagctcctttttcaccaatgccaatagttactca
acaactacaaccaccagcaacatgggaattatgaactttaccaccagcggatcagcaggg
accaactctcaagggcagacagcccagagggtcagtgggctacaggggtctgatgctcta
aacatccagcagaaccagacatctggtggctctctgcaagcaagtcagcaaaaagaggga
gagcaaaaccagcagacacagcaacagcaacagcaacaaattcttatccagcctcagcta
gtacaagggggacaggctcttcaggcccttcaggcagcaccattgtcagggcagaccttt
acaacccaagctatctcccaggaaaccctccagaatctccagcttcaggctgttccaaac
tctggccccatcatcatccggacaccaacagtggggcccaatggacaggtcagttggcag
actcttcagctgcagaatctacaagttcagaacccacaggcccagacaatcaccttggcc
ccaatgcagggtgtttccttggggcagaccagcagcagcaataccacccttacacccatt
gcctcagctgcctccatccctaccggcacagtcactgtgaatgctgctcagctttcctcc
atgcctggcctccagaccattaacctcagtgcgttgggtgcttcaggaatccaggtgcat
cagcttccaagcctgcccttggctatagcaaatgccccaggtgatcatggagctcagctt
ggcctccatggggctggtggtgatggaatacatgatgacacagcaggtggagaagaaggg
gaaaacagcccagatccccagccccaagctggtcggaggacccggcgggaagcatgcacc
tgcccctactgtaaagatagtgaaggaaggggctctggggatcctggcaaaaagaaacag
cacatttgccacatccaaggctgtggcaaagtatatggcaagacctcgcacctacgggca
cacttgcgctggcatacaggcgagaggccattcatgtgtacctggtcatactgtgggaaa
cgctttacacgttcggatgagctacagagacacaaacgcacgcatacaggtgagaagaaa
tttgcctgtcccgagtgtcccaagcgcttcatgaggagtgaccacctgtcaaagcatatc
aagacccaccagaataagaagggaggcccaggtgtatccctgagtgtgggcactttgccc
ctggacagtggggcaggttcagaaggcagcggcactgccaccccttcagctcttattacc
accaatatggtagccatggaggccatctgtccagagggtattgcccgtcttgccaacagt
ggcatcaacgtcatgcaggtggcggatctgcagtccattaatatcagtggcaatggcttc
tga

DBGET integrated database retrieval system