KEGG   Ursus maritimus (polar bear): 103675597Help
Entry
103675597         CDS       T03271                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr05034  Alcoholism
umr05165  Human papillomavirus infection
umr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    103675597 (HDAC7)
  09165 Substance dependence
   05034 Alcoholism
    103675597 (HDAC7)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    103675597 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103675597 (HDAC7)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103675597 (HDAC7)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103675597 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103675597
NCBI-ProteinID: XP_008702941
LinkDB All DBs
Position
Un
AA seq 913 aa AA seqDB search
MAKARLEERKLELAGVFPSQGLEGLKQHLSYEPSRPVPVTAAAARRSCCGALEMRPVRTA
VCFKYGMHTGSQRLSLKKGYGTQVSPGARCPSPPGTGAVASSVVKQKLAEVILKKQQAAL
ERTVHPNSPSIPYRTLEPLETEGAARSMLSSFLPPVPSLPNDPPEHFPLRKTVSEPNLKL
RYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNP
VLGSEAWLGQRLRLQETSLAPFALPTVSLLPAITLGLPAPARADADRRTHPTLGPRGPVL
GSPHAPLFLPHGLEPEAGGPLPSRLQPILLLDPSVSHTPLLTVPGLGPLPLHFAQSLLTT
ERLSGSGLHRPLSRTRSEPLPPSATAPPPLGPLQPRLERLKPHVQLIKRPAKPSEKPRLR
QIPSAEDLETDGGGVGPVGDDGLEHRESSHGQHEARGPVPLQHQQVFLWEQQRLAGRLPR
GGTGDSVLLPLAQGSHRPLSRAQSSPAAPASLPTPEPASQARVLPSSEAPARTLPFTTGL
VYDSVMLKHHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSS
NAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQ
GKASKILIMDWDVHHGNGTQQTFYQDPGVLYISLHRHDDGNFFPGSGAADEVGAGSGEGF
NVNVAWAGGLDPPMGDPEYLAAFRMVVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHV
SAKCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVDPLSEEGWKQK
PNLNAIRSLEAVIRVHSKYWGCMQRLASRPDSWALRVPGTDTEEVEAVTALASLSRPAYV
NHLSALVEQTGAS
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggccaggctggaggagcggaagctggagctcgcaggcgtcttccccagccag
ggactagaagggctgaagcagcatctcagctacgagccatctcgacccgtgccggtcact
gcggcggctgctcgccgctcgtgctgcggggcgctggaaatgcggccggtcaggactgca
gtgtgcttcaagtatggaatgcacaccggatctcaaagacttagtctgaagaaaggatat
gggacccaggtgagcccgggtgcccgctgccccagtccccctggcacaggtgccgtagcc
agcagcgtggtcaagcagaaactggcagaggtgattctaaagaaacagcaggcagcccta
gagagaacagtgcaccccaatagccccagcattccctacagaacccttgagcccttggag
acggaaggagctgctcgctctatgctcagcagctttctgcctcctgttcccagcctgccc
aatgaccccccagaacacttccctctccgaaagacagtctctgagcccaacctgaagctg
cgctacaagcccaagaagtccctggagcggaggaagaatccgctgctcagaaaggagagc
gccccgcccagtctccggcggcggcccgcggagacccttggtgactcctccccaagtagc
agcagcacgccagcctcgggctgcagttcccctaatgacagcgagcacggccccaaccca
gtcctgggctccgaggcatggctgggccagcggctgcgtttgcaggagacctctctggcc
ccgttcgccttgccgactgtgtccttgctgcccgcaatcacgctggggctacctgcccct
gccagggctgatgctgaccgcaggacccatccgactctgggccctcgggggccggtcctg
gggagcccccatgctcccctcttcctgccccatggcctggagcctgaggctggaggcccc
ttgccctctcgactacagcccatcctcctcttggatccctcagtttctcacacccctctg
ctgactgtgcccgggcttgggcccctgcccctccactttgcccagtccttactgaccacc
gagcggctctctgggtcaggcctccaccggccactaagccggacccgctcagagcccctg
cccccaagcgccaccgcccccccaccgctgggccccctgcagccccgcctggaacggctc
aaacctcacgtccagctgatcaagaggccagccaagccaagtgagaagccccgactgcgg
cagataccctccgctgaggacctagagacggatggcgggggagtggggccagtgggggat
gacggcctggaacacagggagtcaagccacgggcagcatgaggccagaggccctgttcct
ctccagcaccagcaggtgttcctctgggagcagcagcgactggctgggcggctcccccgg
ggaggaactggggactctgtgctgcttcccttggcccagggcagtcaccggcccctgtcc
agggctcagtcgtccccagccgcgcctgcctcactgccaactccagagcccgccagtcag
gcccgtgtcctgcccagctcggaggcccctgccaggaccctgccattcaccacagggctg
gtctatgactcggtcatgctgaagcaccatgtgctcctgtatggcaccaacccactcagc
cgcctcaaactggacaacgggaagctggcagggctcctggcacagcggatgtttgtgatg
ctgccctgtggtggggtaggggtggatactgacaccatctggaacgagctgcactcctcc
aatgcagcccgctgggccgccggcagcgtcaccgacctcgccttcaaagtagcttcccgt
gagctaaagaatggttttgctgtggttcggcccccaggacaccatgcagaccattccaca
gccatgggcttctgcttcttcaactctgtggccatcgcctgccggcagcttcaacaacag
ggcaaggccagcaagatcctcatcatggactgggatgttcaccacggcaacggcacccag
cagaccttctaccaggaccccggtgtgctgtacatctccctgcatcgccacgacgacggc
aacttcttccccggcagcggggccgcggatgaggtgggagctggtagtggtgagggcttc
aatgtcaacgtggcctgggcgggaggtctggaccccccgatgggggatcctgagtacctg
gctgccttcaggatggtcgtgatgcccatcgcccgagagttctctccggacctggtcctg
gtgtcagctgggtttgatgccgccgagggtcacccagccccactgggtggctaccatgtt
tccgctaaatgtttcgggtacatgacgcagcagctgatgagcttggcggggggcgccgtg
gtgctggccttggaaggtggccatgacctcacagccatctgtgatgcttctgaggcctgc
gtggctgctcttctggggaacaaggtggatcctctctcagaagagggctggaaacagaaa
cccaacctcaacgccatccgctctttggaagccgtgatccgggtgcacagtaaatactgg
ggctgcatgcagcgcctggcttcccgtccagactcctgggcgctcagggtgccaggcacc
gacacggaagaagtggaggcagtgactgcgttggcatccctctccaggccagcctacgtc
aaccatctcagtgccctggtggagcagacgggtgcttcctga

DBGET integrated database retrieval system