KEGG   Ursus maritimus (polar bear): 103675597Help
Entry
103675597         CDS       T03271                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr05034  Alcoholism
umr05165  Human papillomavirus infection
umr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    103675597 (HDAC7)
  09164 Substance dependence
   05034 Alcoholism
    103675597 (HDAC7)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    103675597 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103675597 (HDAC7)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103675597 (HDAC7)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103675597 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103675597
NCBI-ProteinID: XP_008702941
LinkDB All DBs
Position
Un
AA seq 913 aa AA seqDB search
MAKARLEERKLELAGVFPSQGLEGLKQHLSYEPSRPVPVTAAAARRSCCGALEMRPVRTA
VCFKYGMHTGSQRLSLKKGYGTQVSPGARCPSPPGTGAVASSVVKQKLAEVILKKQQAAL
ERTVHPNSPSIPYRTLEPLETEGAARSMLSSFLPPVPSLPNDPPEHFPLRKTVSEPNLKL
RYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNP
VLGSEAWLGQRLRLQETSLAPFALPTVSLLPAITLGLPAPARADADRRTHPTLGPRGPVL
GSPHAPLFLPHGLEPEAGGPLPSRLQPILLLDPSVSHTPLLTVPGLGPLPLHFAQSLLTT
ERLSGSGLHRPLSRTRSEPLPPSATAPPPLGPLQPRLERLKPHVQLIKRPAKPSEKPRLR
QIPSAEDLETDGGGVGPVGDDGLEHRESSHGQHEARGPVPLQHQQVFLWEQQRLAGRLPR
GGTGDSVLLPLAQGSHRPLSRAQSSPAAPASLPTPEPASQARVLPSSEAPARTLPFTTGL
VYDSVMLKHHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSS
NAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQ
GKASKILIMDWDVHHGNGTQQTFYQDPGVLYISLHRHDDGNFFPGSGAADEVGAGSGEGF
NVNVAWAGGLDPPMGDPEYLAAFRMVVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHV
SAKCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVDPLSEEGWKQK
PNLNAIRSLEAVIRVHSKYWGCMQRLASRPDSWALRVPGTDTEEVEAVTALASLSRPAYV
NHLSALVEQTGAS
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggccaggctggaggagcggaagctggagctcgcaggcgtcttccccagccag
ggactagaagggctgaagcagcatctcagctacgagccatctcgacccgtgccggtcact
gcggcggctgctcgccgctcgtgctgcggggcgctggaaatgcggccggtcaggactgca
gtgtgcttcaagtatggaatgcacaccggatctcaaagacttagtctgaagaaaggatat
gggacccaggtgagcccgggtgcccgctgccccagtccccctggcacaggtgccgtagcc
agcagcgtggtcaagcagaaactggcagaggtgattctaaagaaacagcaggcagcccta
gagagaacagtgcaccccaatagccccagcattccctacagaacccttgagcccttggag
acggaaggagctgctcgctctatgctcagcagctttctgcctcctgttcccagcctgccc
aatgaccccccagaacacttccctctccgaaagacagtctctgagcccaacctgaagctg
cgctacaagcccaagaagtccctggagcggaggaagaatccgctgctcagaaaggagagc
gccccgcccagtctccggcggcggcccgcggagacccttggtgactcctccccaagtagc
agcagcacgccagcctcgggctgcagttcccctaatgacagcgagcacggccccaaccca
gtcctgggctccgaggcatggctgggccagcggctgcgtttgcaggagacctctctggcc
ccgttcgccttgccgactgtgtccttgctgcccgcaatcacgctggggctacctgcccct
gccagggctgatgctgaccgcaggacccatccgactctgggccctcgggggccggtcctg
gggagcccccatgctcccctcttcctgccccatggcctggagcctgaggctggaggcccc
ttgccctctcgactacagcccatcctcctcttggatccctcagtttctcacacccctctg
ctgactgtgcccgggcttgggcccctgcccctccactttgcccagtccttactgaccacc
gagcggctctctgggtcaggcctccaccggccactaagccggacccgctcagagcccctg
cccccaagcgccaccgcccccccaccgctgggccccctgcagccccgcctggaacggctc
aaacctcacgtccagctgatcaagaggccagccaagccaagtgagaagccccgactgcgg
cagataccctccgctgaggacctagagacggatggcgggggagtggggccagtgggggat
gacggcctggaacacagggagtcaagccacgggcagcatgaggccagaggccctgttcct
ctccagcaccagcaggtgttcctctgggagcagcagcgactggctgggcggctcccccgg
ggaggaactggggactctgtgctgcttcccttggcccagggcagtcaccggcccctgtcc
agggctcagtcgtccccagccgcgcctgcctcactgccaactccagagcccgccagtcag
gcccgtgtcctgcccagctcggaggcccctgccaggaccctgccattcaccacagggctg
gtctatgactcggtcatgctgaagcaccatgtgctcctgtatggcaccaacccactcagc
cgcctcaaactggacaacgggaagctggcagggctcctggcacagcggatgtttgtgatg
ctgccctgtggtggggtaggggtggatactgacaccatctggaacgagctgcactcctcc
aatgcagcccgctgggccgccggcagcgtcaccgacctcgccttcaaagtagcttcccgt
gagctaaagaatggttttgctgtggttcggcccccaggacaccatgcagaccattccaca
gccatgggcttctgcttcttcaactctgtggccatcgcctgccggcagcttcaacaacag
ggcaaggccagcaagatcctcatcatggactgggatgttcaccacggcaacggcacccag
cagaccttctaccaggaccccggtgtgctgtacatctccctgcatcgccacgacgacggc
aacttcttccccggcagcggggccgcggatgaggtgggagctggtagtggtgagggcttc
aatgtcaacgtggcctgggcgggaggtctggaccccccgatgggggatcctgagtacctg
gctgccttcaggatggtcgtgatgcccatcgcccgagagttctctccggacctggtcctg
gtgtcagctgggtttgatgccgccgagggtcacccagccccactgggtggctaccatgtt
tccgctaaatgtttcgggtacatgacgcagcagctgatgagcttggcggggggcgccgtg
gtgctggccttggaaggtggccatgacctcacagccatctgtgatgcttctgaggcctgc
gtggctgctcttctggggaacaaggtggatcctctctcagaagagggctggaaacagaaa
cccaacctcaacgccatccgctctttggaagccgtgatccgggtgcacagtaaatactgg
ggctgcatgcagcgcctggcttcccgtccagactcctgggcgctcagggtgccaggcacc
gacacggaagaagtggaggcagtgactgcgttggcatccctctccaggccagcctacgtc
aaccatctcagtgccctggtggagcagacgggtgcttcctga

DBGET integrated database retrieval system