KEGG   Ursus maritimus (polar bear): 103675706
Entry
103675706         CDS       T03271                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04260  Cardiac muscle contraction
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04727  GABAergic synapse
umr04728  Dopaminergic synapse
umr04742  Taste transduction
umr04911  Insulin secretion
umr04912  GnRH signaling pathway
umr04921  Oxytocin signaling pathway
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04927  Cortisol synthesis and secretion
umr04929  GnRH secretion
umr04930  Type II diabetes mellitus
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05410  Hypertrophic cardiomyopathy
umr05412  Arrhythmogenic right ventricular cardiomyopathy
umr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103675706 (CACNA1C)
   04020 Calcium signaling pathway
    103675706 (CACNA1C)
   04024 cAMP signaling pathway
    103675706 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    103675706 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103675706 (CACNA1C)
   04929 GnRH secretion
    103675706 (CACNA1C)
   04912 GnRH signaling pathway
    103675706 (CACNA1C)
   04921 Oxytocin signaling pathway
    103675706 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    103675706 (CACNA1C)
   04924 Renin secretion
    103675706 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    103675706 (CACNA1C)
   04927 Cortisol synthesis and secretion
    103675706 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103675706 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    103675706 (CACNA1C)
   04270 Vascular smooth muscle contraction
    103675706 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    103675706 (CACNA1C)
   04727 GABAergic synapse
    103675706 (CACNA1C)
   04725 Cholinergic synapse
    103675706 (CACNA1C)
   04728 Dopaminergic synapse
    103675706 (CACNA1C)
   04726 Serotonergic synapse
    103675706 (CACNA1C)
   04720 Long-term potentiation
    103675706 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    103675706 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    103675706 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103675706 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103675706 (CACNA1C)
   05020 Prion disease
    103675706 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    103675706 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    103675706 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103675706 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103675706 (CACNA1C)
   05414 Dilated cardiomyopathy
    103675706 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103675706 (CACNA1C)
   04934 Cushing syndrome
    103675706 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:umr04040]
    103675706 (CACNA1C)
Ion channels [BR:umr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103675706 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 103675706
NCBI-ProteinID: XP_008703046
UniProt: A0A384D7V8
LinkDB
Position
Un
AA seq 2103 aa
MNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKP
KKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKYPLPFEIIILLTIFANCVALAIYIP
FPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVG
LFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMV
PLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQC
QNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFV
SLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAED
IDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYW
RRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLAL
FTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLR
IFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRR
STFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLN
VFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKPAVEETKEEKIEL
KSITADGESPPTTKINMDDLQPNENEDKCPYPNPENTGEEDEEEPEMPVGPRPRPLSELH
LKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHT
SFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGI
QSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACI
GVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMM
ALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVI
VTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMF
VLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVF
DFLIVIGSIIDVILSETNNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSF
QALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEA
WQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMD
NFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHR
VACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTS
MKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRT
LHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVTYYQSDGRSA
FPQTFTTQRPLHINKAANSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGR
FPRPAGYPSAVSTVEGHGPPLSPAVRVQEAAWKLSSKRCHSRESQIAMVCQEEVSQDETY
DVKMSEDTEYCSEPSLISTEMLSYQDDENRQLTPPEEDKRDVRQSPKRGFLRSASLGRRA
SFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPSTFPRPCATPPA
TPGSRGWPPQPIPTLRLEGAESSEKLNSSFPSIHCSSWSGEPTPCGAGSSAIRRARPVSL
TVPSQAGARGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMEN
AADNILSGGAQQSPNGTLLPFVNCRDPGQDRAGGQEGETCAAALACRKSEEELQDSRAHA
GGL
NT seq 6312 nt   +upstreamnt  +downstreamnt
atgaatgccaatgccgctgcggggctcgcccctgagcacatccctacgccgggggcagcc
ctgtcctggcaggcggctatcgacgcggcccggcaggccaagctgatgggcagcgccggc
aacgcgaccatctccacggtcagctccacgcagcggaagcggcagcagtatgggaaaccc
aagaagcagggcagcacgactgccacgcgcccgccccgcgccctgctctgcctgactctg
aagaaccccatccggagggcatgcatcagcatcgtcgaatggaaatatcctttaccattt
gaaataattattttactgactatttttgccaattgtgtggccttagcgatctatattccc
tttccagaagacgactccaacgccaccaattccaacctggaacgagtggaatatctcttt
ctcataatttttactgtggaagcatttttaaaagtaatagcctatggacttctctttcat
cccaacgcttacctccgcaatggttggaatttactagattttataattgtggttgtaggg
ctttttagtgcaattttagaacaagcaaccaaagctgacggggcaaatgctctgggaggg
aaaggagctggatttgacgtgaaggcactgagggcattccgcgtgctgcgccccttgcgc
ctggtatctggagtcccaagtctccaggtggttctgaattccattatcaaggccatggtg
cccctgctgcatattgctctgttagtgctgtttgtaatcatcatctatgccatcattggc
ctggagctcttcatggggaagatgcataagacctgctacaaccaggagggcatagcagat
gttccagcagaagatgatccttccccttgtgctctggagacaggccatgggcgtcagtgt
cagaacggcactgtgtgcaagcctgggtgggacgggcccaagcacggcatcaccaacttc
gacaattttgccttcgccatgttgacagtgttccagtgcatcaccatggagggctggaca
gacgtcctgtactggatgcaggacgctatgggctatgagttaccctgggtgtattttgtc
agtctggtcatctttggatcctttttcgttctaaatctggttctcggtgtgttgagcgga
gagttctccaaagagagggagaaggccaaggctcggggagatttccagaaacttcgagag
aagcagcagctggaagaggatctgaagggctacctggactggatcacccaggcagaggac
attgaccctgagaatgaggatgaaggcatggatgaggagaagccccgaaacatgagtatg
cccacaagcgagaccgagtctgtcaacaccgaaaacgtggctggaggtgacatcgaggga
gagaactgcggggccaggctggcccaccggatttccaaatcaaagttcagccgctactgg
cgccgctggaatcggttctgcagaagaaagtgtcgtgccgcagtcaagtctaatgtcttc
tactggcttgtgatcttcctggtgttcctcaacactctcaccattgcctcggaacactac
aaccagccccactggctcacggaggtgcaagacacggccaacaaggcgctgctggccctt
ttcactgcagagatgctgctgaagatgtacagcctgggcctgcaggcctacttcgtgtcc
ctcttcaaccgcttcgactgtttcatcgtgtgtggtggcatcctggagaccatcctggtg
gagaccaagatcatgtctcccttgggcatctctgtgttgagatgtgtccggctactgcgg
atatttaaaatcacaaggtactggaactccttaagcaacctggtggcatccttgctgaat
tctgtgcgctccattgcctccctactgctgctcctcttcctcttcatcatcatcttctcc
ctcctggggatgcagctctttggaggaaagttcaactttgatgaaatgcagacccggagg
agcacatttgataactttccccagtccctcctcaccgtgtttcagatcctgaccggggag
gactggaattcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggg
atgttagtctgtatttacttcatcatcctcttcatctgtggaaactatatcctactgaat
gtgttcttggccattgctgtggacaacctggctgatgctgagagcctcacatctgcccaa
aaggaggaagaagaagagaaggagagaaagaagctggccaggactgccagcccagagaag
aaacaagaggtggtggagaagccagcagtagaggagaccaaggaggagaaaattgaactg
aaatccattacagctgatggagagtccccacccaccaccaagatcaacatggatgacctc
cagcccaatgaaaatgaggataagtgcccctaccccaacccagaaaatacaggagaagag
gatgaggaggagcctgagatgcctgtgggcccccgcccacgaccactctctgagctgcac
cttaaggaaaaggcagtgcccatgccagaagccagtgcgtttttcatcttcagccccaac
aacagatttcgcctccagtgtcaccgcattgtcaatgacacgatcttcaccaacctgatc
ctcttcttcattctgcttagcagcatttccctggcagctgaggaccccgtccagcacacc
tccttcaggaaccatatcctaggcaatgcagactatgtcttcactagtatctttacatta
gaaattatccttaagatgactgcttatggggctttcctacacaagggctctttttgccga
aactacttcaacatcttggacctgctggtggtcagcgtgtccctcatttcctttggcatc
cagtcaagtgcaatcaacgtggtgaagatcttacgagtcctgcgagtcctcagaccccta
agggccatcaacagggccaaggggctgaagcacgtggttcagtgcgtgttcgtcgccatc
cggaccatcgggaacatcgtcattgtcaccacgctactccagttcatgttcgcctgcatc
ggggtccagcttttcaagggaaagctctacacctgctcagatagttccaaacagactgag
gcggaatgcaagggtaactacatcacatacaaggacggggaggtcgaccaccccatcatc
caaccccgcagctgggagaacagcaagtttgactttgacaatgttctggcagccatgatg
gccctctttaccgtctctacctttgaggggtggccagagctgctgtaccgctccatcgac
tcccacacagaagacaagggccccatctacaactaccgtgtggagatctccatctttttc
atcatctacatcatcatcattgccttcttcatgatgaacatcttcgtgggtttcgtcatc
gtcaccttccaagagcagggggagcaggaatacaagaactgtgagctggacaagaaccag
cgacagtgcgtggaatatgccctcaaggcccggcccctacggaggtacatccccaagaac
cagcaccagtacaaagtgtggtacgtggtcaactccacctactttgaatacctgatgttc
gtcctcatcctgctcaacaccatctgcttggccatgcagcactatggccagagctgcctc
ttcaaaattgccatgaacatcctcaacatgctcttcactggcctcttcaccgtggagatg
attctgaagctcattgccttcaaacccaagggttactttagtgatccctggaatgttttt
gacttcctcatcgtaattggcagcataattgacgtcattctcagtgaaactaataacgca
gaggagaactcccgcatctccatcaccttcttccgcctcttccgggtcatgcgcctggtc
aagctgctgagccgcggagagggcatccggaccctgctgtggaccttcatcaaatccttc
caggccctgccctatgtggcccttctgatagtgatgctgttcttcatctatgcggtgatt
gggatgcaggtgtttgggaaaattgccctgaatgacaccacagagatcaaccggaacaac
aacttccagaccttcccccaagctgtgctgcttctcttcaggtgtgccaccggggaggca
tggcaggacatcatgctggcctgcatgccagggaagaagtgtgcccccgaatcggagccc
agcaacagcacagaaggcgaaacaccctgtggcagcagcttcgcggtcttctacttcatc
agcttctacatgctttgtgccttcctgatcatcaacctctttgtagctgtcatcatggac
aactttgactacctgacaagggactggtcaattcttggtccccatcatctggatgaattt
aaaagaatctgggcagagtatgatcctgaagccaagggtcgtatcaagcacctagatgtg
gtgaccctgcttcgacggatccagcccccactgggttttgggaagctgtgccctcaccgc
gtggcttgcaaacgcctggtctccatgaacatgcctctgaacagtgatgggacagtcatg
ttcaatgccaccctgtttgccctggtccggacagccctgcgaatcaaaacagaagggaac
ctagaacaagccaatgaggagctgcgggccataatcaagaagatatggaagcggaccagc
atgaagctgttggaccaagtggtgcccccagcaggtgatgacgaggtcacagttggcaag
ttttatgctactttcctgatccaagagtatttccggaaattcaagaagcgcaaagagcag
ggcctagtgggcaagccctcccagaggaacgccctgtccctacaggccggcttgcgcacg
ctgcatgacatcgggcctgagatccgacgggccatctctggggatctgacggctgaggag
gagctggacaaggccatgaaggaggctgtgtctgctgcctccgaagacgacatcttcagg
agggccggtggcctgttcggcaaccacgtcacctactaccaaagcgacggccggagcgcc
ttcccccagaccttcaccacccagcgcccactgcacatcaacaaggcggctaacagccaa
ggcgacaccgagtcgccatcccacgagaaactggtggactccactttcacccccagcagc
tactcgtccactggctccaacgccaacatcaacaatgccaacaacactgccctgggccgc
ttcccccgccccgctggttaccccagcgcggtcagcaccgtggagggccatgggcccccc
ttgtctcctgccgtccgggtacaggaggcagcatggaagctcagctccaagaggtgccac
tcccgggagagccagatagccatggtgtgtcaggaggaggtctctcaggacgagacctat
gacgtgaagatgagcgaagacaccgagtactgcagcgagcccagcctgatctccacagag
atgctctcctaccaggatgatgaaaatcggcaattaacaccacctgaggaggacaagaga
gacgtccggcaatctccaaagaggggtttcctccgctctgcctcactaggtcgaagggcc
tccttccacctggaatgtctgaagcgacagaagaatcaagggggagacatctctcagaag
acagtcctgcccttgcatctggttcaccatcaggcattggcagtggcgggcctgagcccc
ctcctccagagaagccattcccccagcacgttccccaggccatgtgccacccccccagcc
acgccgggcagccgaggctggcccccacagccgatccccaccctgcggctggagggggcc
gagtccagcgagaaactcaacagcagcttcccgtccatccactgcagctcttggtctggg
gagcccacgccctgcggtgcgggcagcagcgccatccggagagcccggccggtgtccctc
actgtgcccagccaggctggggcccggggcaggcagttccacggcagcgccagcagcctg
gtggaagcggtcttgatttcagaaggactggggcagtttgctcaagatcccaagtttatc
gaggtcacaacccaggagctggctgacgcctgtgacatgaccatagaagagatggagaac
gccgccgacaacatcctcagtgggggcgcccagcagagccccaacggcaccctactacct
tttgttaactgcagggacccagggcaggacagagcggggggccaagagggcgagacctgc
gccgcggctctggcgtgtcggaaaagcgaggaggagctccaggacagcagagcccacgcc
ggcggcctgtag

DBGET integrated database retrieval system