KEGG   Ursus maritimus (polar bear): 103676164
Entry
103676164         CDS       T03271                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04064  NF-kappa B signaling pathway
umr04066  HIF-1 signaling pathway
umr04071  Sphingolipid signaling pathway
umr04115  p53 signaling pathway
umr04140  Autophagy - animal
umr04141  Protein processing in endoplasmic reticulum
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04215  Apoptosis - multiple species
umr04217  Necroptosis
umr04261  Adrenergic signaling in cardiomyocytes
umr04340  Hedgehog signaling pathway
umr04510  Focal adhesion
umr04621  NOD-like receptor signaling pathway
umr04630  JAK-STAT signaling pathway
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04915  Estrogen signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr05014  Amyotrophic lateral sclerosis
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05161  Hepatitis B
umr05162  Measles
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05215  Prostate cancer
umr05222  Small cell lung cancer
umr05226  Gastric cancer
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103676164 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    103676164 (BCL2)
   04630 JAK-STAT signaling pathway
    103676164 (BCL2)
   04064 NF-kappa B signaling pathway
    103676164 (BCL2)
   04066 HIF-1 signaling pathway
    103676164 (BCL2)
   04071 Sphingolipid signaling pathway
    103676164 (BCL2)
   04151 PI3K-Akt signaling pathway
    103676164 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103676164 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    103676164 (BCL2)
   04215 Apoptosis - multiple species
    103676164 (BCL2)
   04217 Necroptosis
    103676164 (BCL2)
   04115 p53 signaling pathway
    103676164 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676164 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103676164 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103676164 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    103676164 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103676164 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    103676164 (BCL2)
   04722 Neurotrophin signaling pathway
    103676164 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676164 (BCL2)
   05206 MicroRNAs in cancer
    103676164 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103676164 (BCL2)
   05226 Gastric cancer
    103676164 (BCL2)
   05215 Prostate cancer
    103676164 (BCL2)
   05222 Small cell lung cancer
    103676164 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103676164 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    103676164 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103676164 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103676164 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103676164 (BCL2)
   05152 Tuberculosis
    103676164 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103676164 (BCL2)
   05161 Hepatitis B
    103676164 (BCL2)
   05162 Measles
    103676164 (BCL2)
   05168 Herpes simplex virus 1 infection
    103676164 (BCL2)
   05169 Epstein-Barr virus infection
    103676164 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103676164 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103676164 (BCL2)
   01524 Platinum drug resistance
    103676164 (BCL2)
   01522 Endocrine resistance
    103676164 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:umr01009]
    103676164 (BCL2)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103676164 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 103676164
NCBI-ProteinID: XP_008703578
UniProt: A0A384D950
LinkDB
Position
Un
AA seq 195 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGAAAAAGPAPSPVPPVVHLTLRQAGDDF
SRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNR
EMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLA
LVGACITLGAYLGHK
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgccggagccgccgccgccgcgggccct
gcacccagccccgtgccacctgtggtccacctgaccctgcgccaggccggcgatgacttc
tcccgtcgctaccgccgcgacttcgcggagatgtccagccagctgcacctgacacccttc
accgcaaggggacgctttgccacggtggtggaggagctcttcagggatggggtgaactgg
gggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgg
gagatgtcgcccctggtggacaacattgccctgtggatgactgagtacctgaaccggcac
ctgcacacctggatccaggacaacggaggctgggatgcctttgtggagttgtacggcccc
agcatgcagcctctgtttgacttctcctggctgtctctgaaggccctgctcagtctggcc
ctggtgggagcttgcatcaccctgggtgcctacctgggccacaagtga

DBGET integrated database retrieval system