KEGG   Ursus maritimus (polar bear): 103676557
Entry
103676557         CDS       T03271                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00860  Porphyrin and chlorophyll metabolism
umr01100  Metabolic pathways
umr04066  HIF-1 signaling pathway
umr04216  Ferroptosis
umr04978  Mineral absorption
umr05200  Pathways in cancer
umr05206  MicroRNAs in cancer
umr05225  Hepatocellular carcinoma
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    103676557 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    103676557 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    103676557 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    103676557 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676557 (HMOX1)
   05206 MicroRNAs in cancer
    103676557 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103676557 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103676557 (HMOX1)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     103676557 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 103676557
NCBI-ProteinID: XP_008703982
UniProt: A0A384DAB3
LinkDB
Position
Un
AA seq 229 aa
MPEDLSEALKEATKEVHVQAXXXXXXXXXXEFMKNFQKGQVTRKGFKLVMASLYHVYVAL
EEEIERNKDNPVYAPLYFPEELHRKAALERDMAFWYGPRWQEAIPYTQATRRYVQRLQEV
GREEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPASGEGVDFFSFPSIASATKFKQL
YRSRMNTLEMTPEVRQRVLEEAKTAFLLNIQVRGWWPAVAAVWGAAGCG
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcccgaggatttgtcagaggccctgaaggaggccaccaaggaggtgcacgtccaggcg
gannnnnnnnnnnnnnnnnnnnnnnnnnnagagttcatgaagaacttccagaagggccag
gtgacccgaaaaggctttaagctggtgatggcctctctgtaccacgtctacgtggccctg
gaggaggagatcgagcgcaacaaggacaacccggtatacgcccccctttacttcccggag
gagctgcaccgcaaggccgccctggagcgggacatggccttctggtacggcccccgctgg
caggaggccatcccctacacgcaggccacgcggcgctacgtgcagcgactccaggaggtg
gggcgcgaggagccagagctgctggtggcccacgcctacacccgctacctcggcgacctg
tcggggggccaggtcctcaagaagatcgcgcagaaggccctggacctgcccgcctccggg
gagggcgtggacttcttctccttccccagcatcgccagcgccaccaagttcaagcagctc
taccgctcccgcatgaacactctggagatgacccccgaggtcaggcagagggtcctcgaa
gaggctaagactgcatttctgctcaacattcaggtgaggggctggtggcctgcggtggcc
gctgtctggggtgctgcgggctgtgggtaa

DBGET integrated database retrieval system