KEGG   Ursus maritimus (polar bear): 103676585
Entry
103676585         CDS       T03271                                 

Gene name
MET
Definition
(RefSeq) MET proto-oncogene, receptor tyrosine kinase
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04360  Axon guidance
umr04510  Focal adhesion
umr04520  Adherens junction
umr05100  Bacterial invasion of epithelial cells
umr05144  Malaria
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05211  Renal cell carcinoma
umr05218  Melanoma
umr05223  Non-small cell lung cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103676585 (MET)
   04014 Ras signaling pathway
    103676585 (MET)
   04015 Rap1 signaling pathway
    103676585 (MET)
   04020 Calcium signaling pathway
    103676585 (MET)
   04151 PI3K-Akt signaling pathway
    103676585 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103676585 (MET)
   04520 Adherens junction
    103676585 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103676585 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676585 (MET)
   05202 Transcriptional misregulation in cancer
    103676585 (MET)
   05206 MicroRNAs in cancer
    103676585 (MET)
   05205 Proteoglycans in cancer
    103676585 (MET)
   05230 Central carbon metabolism in cancer
    103676585 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103676585 (MET)
   05226 Gastric cancer
    103676585 (MET)
   05218 Melanoma
    103676585 (MET)
   05211 Renal cell carcinoma
    103676585 (MET)
   05223 Non-small cell lung cancer
    103676585 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103676585 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    103676585 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103676585 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103676585 (MET)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103676585 (MET)
Protein kinases [BR:umr01001]
 Receptor tyrosine kinases (RTK)
  MET family
   103676585 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Pkinase_fungal Kinase-like Linker_histone Ninjurin PepSY_TM
Other DBs
NCBI-GeneID: 103676585
NCBI-ProteinID: XP_008704007
UniProt: A0A384DAD6
LinkDB
Position
Un
AA seq 1382 aa
MKAPAVIAPGILVLLFTLVQKSYGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHKH
HIYLGAVNYIYVLNDKDLQKVAEYKTGPVLEHPDCFPCQDCSHKANLSGGVWEDNINMAL
VIDTYYDDQLISCGSVHRGTCQRHVLPPSNTADIQSEVHCMYSPQADEERGQCPDCVVSA
LGTKVLISEKDRFINFFVGNTINSSYHPDHLLHSISVRRLKETQDGFKFLTDQSYIDVLP
EFRDSYPIKYVHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTREEVFNILQAAYVSKPGAHLAKQIGANLNDDILYGVFARSKPDSTEPMNR
SAVCAFPIKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRSDEYRTE
FTTALQRVDLFMGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGSSTPHVNF
RLDSHPVSPEAIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPPFVQCG
WCHDKCVQLEECPTGTWTQEICLPTIYEVSPTSAPLEGGTMLTVCGWDFGFRRNNKFDLK
KTKVLLGNDSCTLTLSESTTNMLKCTVGPAVNEHFNISIIIANGRGTAQYSAFSYVDPII
TSISPSYGPKTGGTLLTLTGKHLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTPTE
FPIKLKIDLANREMNSFSYQEDPIVYAIHPTKSFISGGSTITAVGKNLHSVSVLRMVISV
LEARRNFTVACRHRSNSEIICCTTPSLQQLNLELPLKTKAFFMLDGIHSKNFDLIYVHNP
VFKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCETIYSDSEAVLCKVPND
LLRLNNELNIEWKQAVSSTVLGKVIVQPDQNFTGLIVGVISISLILLLLLGLFLWLKRRK
QIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
SCRQVQYPLTDLSPMLTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKC
WHPKAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNIDGEG
DT
NT seq 4149 nt   +upstreamnt  +downstreamnt
atgaaggcccctgctgtgattgcacctggcatccttgtacttctgtttaccttggtgcag
aagagctatggggagtgcaaagaggcactagtaaagtctgagatgaatgtgaacatgaag
tatcagcttcccaacttcactgcagaaacacccatccagaatgttgttttacacaagcat
catatttacctcggtgcagttaactatatttacgttttaaatgacaaagaccttcagaaa
gttgctgagtacaagactgggcccgtgctggaacacccagattgtttcccatgtcaggac
tgcagccacaaagccaatttatcaggtggcgtttgggaagataacatcaacatggctcta
gttattgacacctactatgatgaccaactcattagctgtggcagtgtccacagagggacc
tgccagcgacatgtccttccacccagcaatactgctgatatacagtcggaagttcattgc
atgtactctccacaggcagacgaagagcgcggccagtgccctgactgtgtggtgagtgcc
ctgggaaccaaagtcctgatatctgaaaaggatcggttcatcaacttcttcgtgggtaac
accataaattcctcgtaccatccagatcatttattgcattcgatatcagtgagaaggcta
aaggaaacgcaagatggtttcaagtttttgacagaccaatcttatattgatgttctacct
gagttcagagattcctaccctattaaatatgtccacgcctttgaaagcaatcattttatt
tactttttgacagtccaacgagaaactctagatgctcagacttttcacacaagaataatc
aggttctgttctgtagactctggattgcattcctacatggaaatgcctctggagtgtatt
ctcacggaaaaaagaagaaagagatccacaagggaggaagtatttaatattctccaagct
gcatatgtcagtaagcctggggcccaccttgctaagcaaataggtgccaacctgaatgat
gacattctctacggagtgtttgcacgaagcaaaccagattctactgaacccatgaatcgt
tctgccgtctgtgcattccctatcaaatatgtcaacgaattcttcaacaagatcgtcaac
aaaaacaatgtgagatgtcttcaacatttttatggacccaaccacgaacactgctttaac
aggacacttttgagaaattcatcaggctgtgaagtgcgcagtgacgaatatcgaacggag
tttaccacagctttgcagcgtgttgacttattcatgggccaattcaaccaagtcctctta
acatctatatctaccttcattaaaggagacctcaccattgctaatcttgggacgtcagag
ggtcgtttcatgcaggttgtggtttctcgatcaggatcgtcaacccctcatgtgaatttt
cgcctggattcccaccctgtgtctccagaagcaattgtggagcacccattaaaccaaaat
ggctacacactggtcgtcactgggaagaaaatcaccaagatcccactgaatggcttaggc
tgtgaacatttccagtcctgcagtcagtgtctctccgcccctccctttgtgcagtgtggc
tggtgccatgacaaatgtgtgcaattggaggaatgccccactggaacatggactcaggag
atctgtctgcctacaatctatgaggtttccccaactagtgcacccttggaaggagggaca
atgctgaccgtatgtggctgggactttggattcaggaggaataataaatttgatttaaag
aaaaccaaagttcttcttggaaatgacagctgcaccttgaccttaagtgagagcacaaca
aatatgctgaaatgcacagttggtcctgcagtgaatgagcatttcaatatatccataatt
attgcaaatggtcgagggacagcacaatatagtgcattttcctatgtggatcctataata
acaagtatttctccaagttatggtcctaagactggcggcaccttgcttactttaactgga
aagcacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtacttta
aaaagtgtgtcagatagtattctcgaatgttataccccagctcaaaccactccaactgag
ttccctattaaactgaaaattgacttagccaaccgagagatgaacagcttcagttaccag
gaagaccccattgtctatgcaattcatccaaccaaatcttttattagtggtgggagcaca
ataacagctgttggaaaaaacctgcattcagttagtgtcctgaggatggtaataagtgta
ctagaagcaagaaggaactttacagtggcatgtcgacatcgctctaattcagagataatc
tgctgtacaactccttcactgcaacagctgaatctggaactccctctgaaaaccaaagcc
tttttcatgttagatgggatccattccaaaaactttgatctcatttatgtacataatcct
gtgtttaagccttttgaaaagccagtgatgatctcaataggcaatgaaaatgtactggaa
attaagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaat
aagagctgtgagactatatactcagattctgaagccgttttatgcaaggtccccaatgac
ctgctgagattgaacaacgagctaaatatagagtggaagcaagcagtttcttcaaccgtc
cttggaaaagtaattgttcaaccagatcagaacttcacaggattgattgttggtgttatc
tcaatatcattaatactcttattattactcgggcttttcctgtggctgaaaaggagaaag
caaattaaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcat
ttggataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaa
tctgtagactaccgagctacttttccagaagaccagtttcctaactcatctcagaatgga
tcatgcagacaagttcagtatcctctgacagacctgtcccccatgcttaccagtggggac
tctgatatatccagtccattactgcaaaatactgtccacattgacctcagtgctctaaat
ccagagctggtccaggcagtccagcacgtagtgattgggccgagtagcctaattgtgcat
ttcaatgaagtcataggaagaggacattttgggtgcgtataccatgggactttgctggac
aatgatgacaagaaaattcactgtgctgtgaaatctttgaatcgaatcactgacatagga
gaagtttcccagtttctgaccgagggaatcatcatgaaagattttagtcatccaaatgtt
ctctcactcttgggaatctgccttcgaagtgaggggtctccgctggtagtcctaccatac
atgaaacatggagatcttcgaaatttcattaggaatgagactcataacccaactgtaaaa
gatcttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaag
tttgtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcactgtcaag
gttgctgattttggtcttgccagagacatgtatgataaagaatactatagtgtacacaac
aaaacaggtgccaagctgcccgtgaagtggatggctttagaaagtctgcaaactcagaag
tttaccaccaagtcagatgtgtggtcctttggtgtgctcctctgggaactgatgacaaga
ggagcaccaccttatcctgacgtcaacacctttgatataacagtttacttgttgcaaggc
agaaggctcctacaacccgaatactgcccagatcccttatatgaagtgatgctcaaatgc
tggcaccctaaagctgaactgcgcccatctttttctgaactggtctccaggatatcagca
atattctctacttttattggggagcactatgtccatgtgaacgctacttatgtgaatgtc
aaatgtgtggctccatacccttctctgctgtcatcacaagataacattgacggcgagggg
gacacatga

DBGET integrated database retrieval system