KEGG   Ursus maritimus (polar bear): 103677688
Entry
103677688         CDS       T03271                                 

Gene name
RB1
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04110  Cell cycle
umr04218  Cellular senescence
umr04934  Cushing syndrome
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05212  Pancreatic cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103677688 (RB1)
   04218 Cellular senescence
    103677688 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103677688 (RB1)
   05203 Viral carcinogenesis
    103677688 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103677688 (RB1)
   05225 Hepatocellular carcinoma
    103677688 (RB1)
   05226 Gastric cancer
    103677688 (RB1)
   05214 Glioma
    103677688 (RB1)
   05220 Chronic myeloid leukemia
    103677688 (RB1)
   05218 Melanoma
    103677688 (RB1)
   05219 Bladder cancer
    103677688 (RB1)
   05215 Prostate cancer
    103677688 (RB1)
   05224 Breast cancer
    103677688 (RB1)
   05222 Small cell lung cancer
    103677688 (RB1)
   05223 Non-small cell lung cancer
    103677688 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103677688 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103677688 (RB1)
   05161 Hepatitis B
    103677688 (RB1)
   05160 Hepatitis C
    103677688 (RB1)
   05163 Human cytomegalovirus infection
    103677688 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103677688 (RB1)
   05169 Epstein-Barr virus infection
    103677688 (RB1)
   05165 Human papillomavirus infection
    103677688 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103677688 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:umr01009]
    103677688 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103677688 (RB1)
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103677688 (RB1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    103677688 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 FAM75 TFIIB
Other DBs
NCBI-GeneID: 103677688
NCBI-ProteinID: XP_008705151
UniProt: A0A384DDQ7
LinkDB
Position
Un
AA seq 900 aa
MDYGVELLGFPLTVHDLELVFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVL
EGYVQRKKELWGICIFIAAVDLDEMPFTFTELQKNIETSVCKFFDLLKEIDTSTKVDNAM
SRLLKKYNVLCALYSKLERTCELIYLTQPSSLISTEINSVLVLKVSWITFLLAKGEVLQM
EDDLVISFQLMLCVLDYFIKLSPPALLKEPYKTAVIPFNGSPRTPRRGQNRSARIAKQLE
NDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGIVASNGLPEVESLSKQYEEIYLKN
KDLDARLFLDHDKTLQADPIDSFEMQRTPRKSNSDEEVNVILPQTPVRTVMNTIQQLMMI
LNSASDQPSENLISYFNNCTVNPKESILKRVKDVGYIFKEKFAKAVGQGCMEIGSQRYKV
GVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDT
GTDLSFPWILNVLNLKAFDFYKVIESFIKAEANLTREMIKHLERCEHRIMESLAWLSDSP
LFDLIKQAKDREGPTDHLESACTLNLTLQSNHTAADMYLSPVRSPKKKGSTIRVNSTANT
EAQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTL
QNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIREEE
YDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISP
LKNPYKISEGVPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNP
PKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNREEK
NT seq 2703 nt   +upstreamnt  +downstreamnt
atggattacggagttgaactgttgggtttcccacttactgtccatgacctcgagcttgtg
tttgaagaaaccgaagaacctgattttactgcattatgtcagaaattaaagataccagat
catgtcagagaaagagcttggttaacttgggagaaagtttcatctgtggatggagtattg
gaaggttatgttcaaaggaaaaaggagctatggggaatctgtatctttattgcagcagtt
gacctagatgagatgccattcacttttactgagctacagaaaaacatagaaaccagtgtc
tgcaaattctttgatttactaaaagaaattgataccagtactaaagttgataatgctatg
tcaagactgttgaagaagtataatgtattgtgtgcactctacagcaaattagaaaggaca
tgtgaacttatatatttgacacaacccagcagtttgatatctactgaaataaactctgtg
ttggtgctaaaagtttcttggatcacgtttttactagcgaaaggggaagtgttacaaatg
gaggatgatctcgtcatctcatttcagttaatgctgtgtgtccttgactattttattaaa
ctctcacctcctgcattgcttaaagaaccatataaaacagctgtaataccttttaatggt
tcacctcgaacaccaaggcgaggtcagaacaggagtgcacggatagcaaaacaactagaa
aatgatacaagaattattgaagttctctgtaaagaacatgaatgtaatatagatgaggtg
aaaaatgtttatttcaaaaatttcataccttttatgaattctcttggaattgtagcttct
aatggacttccagaggtggaaagtctctctaaacaatatgaagagatttaccttaaaaac
aaagatcttgatgcaagattatttctggatcatgataaaactcttcaggctgatcctata
gacagttttgaaatgcagagaacgccacgaaaaagtaactctgatgaagaggtgaatgtg
attcttccacagactccagttaggactgttatgaatactatccaacaattaatgatgatc
ttaaattcagcaagtgatcaaccatcagaaaatttgatttcctattttaataactgcaca
gtgaatccaaaggaaagtatcctgaaaagagtgaaggatgttggatacatctttaaagag
aaatttgctaaagctgtgggacagggatgtatggaaattgggtcacagcgatacaaagtt
ggagtccgattgtattaccgagtaatggaatccatgcttaaatcggaagaagaacgatta
tccattcaaaattttagcaaactgctgaatgacaacatctttcatatgtctttgttggca
tgcgcccttgaggttgtaatggctacatatagcagaagtacatctcagaatcttgatact
ggaacagatttgtccttcccatggattctgaatgtacttaatttaaaagcatttgatttt
tacaaagtgattgaaagttttatcaaagcagaagccaacttgaccagagaaatgataaaa
catttagaacgatgtgaacatcgaatcatggaatcacttgcatggctctctgattcacct
ttatttgatctgattaaacaagcaaaagaccgagaaggaccaactgatcaccttgaatct
gcttgtactctcaaccttactctccagagtaatcacactgcagcagatatgtatctttct
cctgtaagatccccaaagaaaaaaggatcaactatacgtgtaaattctactgcaaacaca
gaggcacaagcaacctcagccttccagactcagaagccattgaaatctacctccctttca
cttttttacaaaaaagtgtaccgactagcatatcttcgactaaataccctgtgtgcacgt
cttctgtctgaccacccagaactagaacacatcatctggaccctttttcagcacacactg
caaaatgagtatgaactcatgagggacaggcatttggatcagattatgatgtgttccatg
tatggcatatgcaaagtgaagaatatagaccttaaattcaaaatcattgtaacagcatac
aaggatcttcctcatgctgttcaggagacattcaaacgtgttttgatcagagaagaggag
tatgattccattatagtattctataactcggtcttcatgcagagactgaaaacaaatatt
ttgcagtatgcttctaccaggccccctaccttgtcaccaatacctcacattcctcgaagc
ccttacaagttttctagttcacctttacggattcctggggggaacatctatatatcaccc
ctgaagaatccatataaaatttcagaaggtgtgccaacgccaacaaaaatgactccaaga
tcaagaatcttagtatcaattggtgaatcatttgggacttctgagaagttccagaaaata
aaccagatggtgtgtaacagcgaccgtgtgctcaagagaagtgctgaaggcagcaaccct
cccaaaccattgaaaaaactacgctttgatattgaaggatcagatgaagccgatggaagt
aaacatctcccaggggagtccaaatttcaacagaaactggcagaaatgacatctacccga
acacgaatgcagaagcaaaaaatgaacgatagcatggatacctcaaacagggaagaaaaa
tga

DBGET integrated database retrieval system