KEGG   Ursus maritimus (polar bear): 103677754
Entry
103677754         CDS       T03271                                 

Gene name
LRP6
Definition
(RefSeq) LDL receptor related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04150  mTOR signaling pathway
umr04310  Wnt signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05200  Pathways in cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103677754 (LRP6)
   04150 mTOR signaling pathway
    103677754 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103677754 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103677754 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103677754 (LRP6)
   05226 Gastric cancer
    103677754 (LRP6)
   05224 Breast cancer
    103677754 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103677754 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    103677754 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103677754 (LRP6)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    103677754 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 103677754
NCBI-ProteinID: XP_008705209
UniProt: A0A384DEF9
LinkDB
Position
Un
AA seq 1462 aa
MYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNL
DGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDI
HAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELL
LLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDG
SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKT
DKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREIIIDQ
LPDLMGLKATNVHRIIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSA
PTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRK
AQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGVV
LKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDS
RLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCP
MHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSES
QFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCSNGQCIGKHKKCDHNVDC
SDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTN
DYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTP
CSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSP
YTERSYSHHLYPPPPSPCTDSS
NT seq 4389 nt   +upstreamnt  +downstreamnt
atgtactggacagactggggagaagtaccaaagatagaacgtgctggaatggatggttca
agtcgattcattataataaacactgaaatttactggccaaatggactgactttggattat
gaggaacagaagctttattgggcagatgcaaaactcaatttcatccacaaatcaaatctg
gatggaacaaatcggcaggcagtggttaaaggttctcttccacatccttttgccttgaca
ttatttgaggacacattgtactggactgactggaatacacactctattttggcttgcaac
aagtacactggcgagggtctgcgtgaaatccattctaacatcttctctcccatggatata
catgccttcagccaacagaggcagccaaatgctacaaatccatgtggaattgataatggt
ggttgttcccacttgtgtttgatgtctccagtcaaacctttttatcagtgtgcttgccca
actggggtcaaactcctggagaatggaaaaacctgcaaagatggtgccactgaattactg
cttttagcacgaaggacagacttgagacgcatttctttggatacaccagatttcacagac
attgttttacagttagaagacatccgtcatgccattgccatagattatgatcctgtggaa
ggctatatctactggactgacgatgaagtgagggccatacgccgctcattcatagatgga
tctggcagtcagtttgtggtcactgctcaaattgcgcatcctgatggtattgctgttgac
tgggttgcccgaaatctttattggacagacactggcactgatcggatagaagtgacaagg
ctcaatgggaccatgaggaagatcttgatttcagaggacttagaggaaccccgagccatt
gtgttagatcccatggttgggtacatgtattggactgactggggagaaatcccgaaaatt
gagcgagcagctctggatggttctgaccgagtagtgttggttaacacttctcttggttgg
ccgaatggtttagccttggattatgatgaaggcaaaatatactggggagatgccaaaaca
gacaaaattgaggttatgaatactgatggcactgggagacgagtactagtggaagacaaa
attcctcacatatttgggtttactttgttgggtgactatgtttactggactgactggcag
agacgtagcatcgaaagagtacacaaacgaagcgcagagagggaaatcatcatagatcag
cttcctgacctcatgggcctaaaggccacaaatgttcatcgaatcattggttccaacccc
tgcgctgaggaaaatgggggatgtagccatctttgcctctataggcctcagggcctccgc
tgtgcctgccccattggctttgaactcatcagtgacatgaagacctgcattgtcccagag
gctttccttttgttttcacggagagcagatatcaggcgaatttctttggaaactaacaat
aataatgtggccattcctctcactggtgtcaaagaagcttctgctttggattttgatgta
acagacaaccgcatttactggactgatatatcactcaagaccatcagcagagcctttatg
aatggcagtgcgctggaacacgtggtagaattcggcttagattatccagaaggcatggca
gtagactggctggggaagaacttgtactgggcagacacaggaacgaatcgaattgaggtg
tcaaagttggatgggcagcaccgacaagttttggtgtggaaagacttagatagtcccaga
gctcttgcactggaccctgctgaaggatttatgtattggactgaatggggtggaaaacct
aagatagaccgagctgccatggatggaagtgaacgtactacattagttccaaatgtggga
cgggcaaatggcttaactattgattatgctaaaaggaggctttattggacagacctggac
accaacttaatagaatcttcaaatatgcttggactcaaccgtgaagttatagcagatgac
ttgcctcatccttttggcttaactcagtaccaagattacatctactggacggactggagc
cgacgcagcattgaacgtgccaacaaaaccagtggccaaaaccgcaccatcattcagggc
catttggattatgtgatggacatcctcgtctttcactcctctcggcaggcggggtggaat
gagtgtgcttccagcaatgggcactgctcccacctctgcttggctgtgccagttggaggt
tttgtttgtggatgccctgcccactactcacttaatgctgacaacaggacttgtagtgct
ccaactactttcctgctcttcagtcaaaagagtgccatcaaccgcatggtgattgatgag
cagcagagccctgacatcatccttcctatccacagccttcggaatgtccgggccattgac
tatgacccactggacaagcaactctattggattgactcacgacaaaacatgatccgaaaa
gcacaagaagacggcagccagggctttactgtcgttgtgagctcagttccaaatcagaac
ctagaaatacaaccctatgacctcagcattgatatttatagccgctacatttactggact
tgtgaggccaccaatgtcattaatgtaacaagattagatgggagatcaattggagtggta
ctaaaaggcgagcaagacagacctcgagccattgtggtgaacccggagaaggggtatatg
tattttaccaatcttcaggaaaggtctcccaaaattgaacgggccgctttggatggaaca
gaacgggaggttctctttttcagtggcttaagtaaaccaattgcgttagcccttgatagc
agattgggcaagctcttttgggcagattcagacctccggcgaattgaaagcagtgatctc
tcaggtgccaaccggatagtattagaagactccaatatcttgcagcctgtgggactgact
gtgtttgaaaactggctatattggattgataagcagcagcaaatgattgaaaaaattgac
atgacaggccgagagggtagaaccaaagtccaggctcgaattgcccagcttagtgacatt
catgcagtgaaagagctgaaccttcaggaatatagacagcacccttgtgctcaggataat
ggtggctgttcacatatttgtcttgtaaaaggagatggtactacaaggtgctcttgcccc
atgcacttggttctgcttcaagacgagctatcatgtggagaacccccaacatgttctcct
cagcagtttacttgtttcacgggagaaattgactgtatccctgtggcttggcgctgcgac
gggtttactgaatgcgaagaccacagtgacgaactcaattgtcctgtatgctcagagtcc
cagttccagtgtgccagtgggcagtgtattgatggtgccctccgatgcaatggagatgca
aactgccaggataaatcagatgagaagaactgtgaagtgctttgtttaattgatcagttc
cgctgttccaacggtcagtgcattggaaaacataagaaatgtgatcataatgtggactgc
agtgacaagtcagatgaactggattgttatccaactgaggaaccagctccacaggccacc
aacacagttggttccgttattggagtaattgtcaccatttttgtgtctggaaccatatac
tttatctgccagagaatgttgtgtccacgtatgaagggggatggggaaaccatgactaat
gactatgtcgttcatggaccagcttctgtgccccttggttatgtgccacatccaagttct
ttgtcaggatctcttccaggaatgtctcgaggtaaatcaatgatcagctccctaagtatc
atggggggaagcagtggacccccttacgaccgagctcatgtcacaggagcatcatcgagt
agttcttcaagcaccaaaggcacttacttccctgcaattttgaaccctccaccatcccca
gccacagagcgatcacattacactatggaatttggttattcttcgaatagtccttccact
cataggtcctacagctacaggccgtacagctaccggcactttgcaccccctaccacaccc
tgcagcacagatgtttgtgacagtgactatgctcccagccggagaatgacctcagtggca
acagccaagggctacactagtgacttgaactatgactcagagcctgtgcccccacctccc
acaccccgaagccaatacctgtcagcagaagagaactatgaaagctgcccaccttctcca
tacacagagaggagctactctcatcacctctacccaccaccgccctctccctgtacagac
tcctcctga

KEGG   Ursus maritimus (polar bear): 103679626
Entry
103679626         CDS       T03271                                 

Gene name
LRP5
Definition
(RefSeq) LDL receptor related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04150  mTOR signaling pathway
umr04310  Wnt signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05200  Pathways in cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103679626 (LRP5)
   04150 mTOR signaling pathway
    103679626 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103679626 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679626 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103679626 (LRP5)
   05226 Gastric cancer
    103679626 (LRP5)
   05224 Breast cancer
    103679626 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103679626 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    103679626 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103679626 (LRP5)
Membrane trafficking [BR:umr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    103679626 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition DUF5050 SGL Ldl_recept_a EGF Insulin_TMD DUF5653
Other DBs
NCBI-GeneID: 103679626
NCBI-ProteinID: XP_008707410
UniProt: A0A384DKT9
LinkDB
Position
Un
AA seq 1648 aa
MAGWLLSILPPVSLHRWERRDPKEAMSPSGRATLARGQATGRLPLPAGEQLIGDRLSVGP
STDDAHTWPGQVVPWLDEWGRARGPGRREPGEPGHRKARRRNGMADVSEEAIKQTYLNQT
GVAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRA
IALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAK
LSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEIL
SALYSPMDIQVLSSERQPYFHTRCAEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGKT
CKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVR
AIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVS
EDLDEPRAIVLHPVMGLMYWTDWGENPKIECAHLDGQERHILVNTSLGWPNGLALDLQEG
KLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVK
ASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATKCGCPIGLELLS
DLKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVS
LKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWVGKNLYWADTGTNRIEVARLDGQFRQVL
VWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYAD
QRLYWTDLDTNMIESSDMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTS
GRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLD
PSSRNCSPPTAFLLFSQKCAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVD
GRQNIKRAKDDGTQPFVLTSPSQSQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLNG
DAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPV
ALVVDNRLGKLFWVDADLKRIESCDLSGANRLTLEDANIMQPVGLTVLGKHLYWIDRQQQ
MIERVEKTTGDKRTRVQGRVAHLTGIHAVEDVSLEEFSAHPCARDNGGCSHICIAKGDGT
PRCSCPVHLVLLQNLLACGEPPTCSPDQFACATGEIDCIPGAWRFQEACELATFAFLVEL
CSTFRILHPGSSAEIAPWRGREHWLVALHLAHLAASHPIASLNARLLLAAVCLPNQFRCA
SGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVY
FVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGSSQHGPFTGISCGKSMMSSVSLM
GGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNADTFYSSNIPST
TRPYRPYIIRGMAPPTTPCSTDVCDSDYSANRWKASKYYLDLNSDSDPYPPPPTPHQKKE
DSCPPSPATERSYFHLFPPPPSPCTDSS
NT seq 4947 nt   +upstreamnt  +downstreamnt
atggcaggctggctcctgtccatcctgcccccagtgtctctccaccggtgggagaggaga
gaccccaaggaggccatgtctcccagtgggagggccacgttggccagggggcaggccacc
gggagacttcccctcccggctggagagcagctgattggagaccgcttgtcagtggggccg
tccaccgacgacgctcacacttggcccgggcaggttgtgccttggctggatgagtgggga
cgagccaggggacctggccgcagggaacctggggagcctgggcaccgtaaagctcgccgg
cggaacgggatggctgacgtgagcgaggaggccatcaagcagacctacctgaaccagacg
ggggtcgccgtgcagaacgtggtcatctctggcctggtgtcacccgacggcctggcctgc
gactgggtcggcaagaagctgtactggacggactcagagaccaaccgcatcgaggtggcc
aacctcaacgggacgtcccggaaggtcctcttctggcaggacctcgaccagccgcgggcc
atcgccttggaccccgctcacgggtacatgtactggacagactggggcgagacacctcga
atcgagcgggcggggatggacggcagcacccggaagatcatagtggactccgacatttac
tggcccaacgggctgaccatcgacttggaggagcagaagctctactgggccgacgccaag
ctcagctttatccaccgtgccaacctggacggttcgttccggcagaaggtggtggagggc
agcctgacgcacccctttgccctgacgctctctggggacactctgtactggacggactgg
cagacccgctccatccacgcctgtaacaagaggaccggagagaagaggaaggagatcctt
agcgccctttattcgcccatggatattcaagtgctcagctcagagcggcagccttacttc
cacacaaggtgtgcagaggacaatggtggctgctcgcacctgtgcctgctgtccccgagg
gagcctttctacacgtgcgcctgccccactggtgtgcagcttcaggacaacggcaagacg
tgcaaggcaggggccgaggaggtgctgctgctggcccggcggacagacctgcggaggatc
tcgctggacacgccggactttaccgacatcgtgctgcaggttgatgacatccggcacgcc
attgccatcgactacgacccgctggagggctacgtctactggacggacgacgaggtgcgg
gccatccgcagggcatacctggacgggtcgggggcacagacgctggtcaacaccgagatc
aatgaccctgacggcattgcggtcgactgggtggcccgcaacctctactggacggacacg
ggcaccgaccgcatcgaggtgacccgtctcaacggcacctcccgcaagatcctggtgtcc
gaggacctggacgagccccgggccatcgtgctgcaccccgtgatgggcctcatgtactgg
acggactggggggaaaaccccaaaatcgagtgcgcccacctggacgggcaggagcgacac
atcctggtgaacacgtccctcggctggcccaacggcctggccctggacctgcaggaggga
aagctgtactggggggatgccaagacggacaaaattgaggtgatcaacgtcgacgggaca
aagaggcggacgctcctggaggacaagctcccacacattttcgggttcacgctgctgggg
gacttcatctactggaccgactggcagaggcgcagcattgagcgtgtgcacaaggtcaag
gccagccgggacgtcatcatcgaccagctgcccgacctgatggggctgaaggccgtgaac
gtggccaaggttgtcggaaccaacccgtgtgcggacaggaacgggggctgcagccacctg
tgtttcttcacgcctcacgcgaccaagtgcggctgccccatcggcctggagctactgagc
gacctgaagacctgcatcgtccccgaggccttcctggtgttcaccagcagagccgccatc
cacagaatctccctggagaccaacaacaatgacgtggccatcccgctgacgggcgtcaag
gaggcctccgcgctggacttcgatgtgtccaacaaccacatctactggacggacgtcagc
ctgaagaccatcagccgagccttcatgaacgggagctccgtggagcacgtgattgagttt
ggcctcgactaccccgagggtatggccgtcgactgggtaggcaagaacctctactgggca
gacactgggaccaacaggatcgaagtggcccggttggatggacagttccggcaggtcctc
gtgtggagggacttggacaaccccaggtcgctggccctggaccccaccaaaggctacatc
tactggaccgagtggggtggcaaacccaggatcgtgcgggccttcatggatgggaccaac
tgcatgacgctggtggacaaggtgggtcgggccaacgacctcaccatcgactacgcggac
cagcgtctctactggaccgacctggacaccaacatgatcgagtcatctgacatgctgggt
caggagcgcgttgtgattgccgacgacctcccacaccccttcggcctgacgcagtacagc
gattacatctactggaccgactggaacctgcacagcatcgagagggccgacaagaccagc
ggccggaaccgcaccctcatccagggccatctggacttcgtgatggacatcctggtgttc
cactcctcccgccaggacggcctcaatgattgcatgcacaacaacgggcagtgtgggcag
ctgtgcctcgccatccctggcggccaccgctgtggctgtgcctcccactacaccctagac
cccagcagccgcaactgcagcccgcccaccgccttcttgctgttcagccagaaatgtgcc
attagccgcatgatccccgacgaccagcacagcccggacctcatcctgccgctgcacggg
ctgaggaacgtcaaggccatcgactatgacccactggacaagttcatctactgggtggat
gggcgccaaaacattaagcgggccaaggatgacgggacccagcccttcgttttgacctct
ccaagccagagccaaaacccggacaggcagccccacgacctcagcatcgacatctatagc
cggacgctgttctggacgtgtgaggctaccaacaccatcaacgtccaccggctgaatggg
gatgccatgggtgtggtgctccgtggggaccgagacaagccacgggccatcgtcgtcaac
gccgagcgagggtacctgtacttcaccaacatgcaggaccgcgcggccaagatcgagcga
gccgccctggatggcaccgagcgtgaggtcctcttcaccaccggcctcatccggcccgtg
gccctcgtggtggacaacaggctgggcaagctcttctgggtggacgcggacctgaagcgc
atcgaaagctgtgacctgtcaggggccaaccgcctgaccctggaggacgccaacatcatg
cagcccgtgggcctgaccgtgctgggcaagcacctctactggattgaccggcagcagcag
atgattgagcgcgtggagaagaccaccggggacaagcggacacgagtccagggccgagtc
gcccacctgaccggcatccacgccgtggaggatgtcagcctagaggagttctcggcccac
ccgtgtgcccgggacaacggcggctgctctcacatctgcattgccaagggtgacgggaca
ccacggtgctcatgcccggtccacctcgtgctcctgcagaacctgctggcgtgtggtgag
cctcccacctgctccccggaccagttcgcgtgtgccaccggggagatcgactgcatcccc
ggggcctggcgcttccaagaggcttgtgagctagctacctttgccttcctggtcgagctc
tgctccaccttccggatcctccaccctgggagctctgctgagatagcgccttggcggggc
agggagcactggttggtggctctccacttagcgcacctggccgcatcacaccccatagcc
tctctgaatgcgagactcctccttgcagccgtctgcctgcccaaccagttccgctgtgcc
agcggccagtgcgtcctcatcaagcagcagtgcgattccttccccgactgcatcgacggc
tccgatgagctcatgtgcgagatcaccaagccgccgtctgatgacagcccggcccacagc
agcgccatcgggccggtcatcggcatcatcctgtccctcttcgtcatgggcggggtctac
ttcgtctgccagcgcgtggtgtgtcagcgctacgccggggccaacgggccctttccgcac
gagtacgtcagtgggaccccccacgttcccctcaatttcatagccccgggcagctcacag
cacggtcccttcacaggcatctcctgtggcaagtccatgatgagctctgtgagcctgatg
gggggccggggtggagtgcccctctatgaccggaaccacgtcaccggggcctcgtccagc
agctcgtccagcaccaaggccaccctgtaccctccgatcctgaacccaccgccatccccc
gccacggacccctccttgtacaacgcggacacattctactcttccaacattcccagcacc
acgagaccctacaggccctacatcatccgaggcatggcgccccccacgacgccctgcagc
accgatgtttgcgacagcgactacagtgccaaccgctggaaggccagcaagtattacctg
gatttgaactcggactcagacccctacccgccgccgcccacgccccaccaaaaaaaagag
gacagctgccccccctcacccgccaccgagcggagctacttccacctcttcccgccccct
ccgtccccctgcacggactcgtcctga

DBGET integrated database retrieval system