KEGG   Ursus maritimus (polar bear): 103677760
Entry
103677760         CDS       T03271                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01522  Endocrine resistance
umr04012  ErbB signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04151  PI3K-Akt signaling pathway
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04934  Cushing syndrome
umr05162  Measles
umr05165  Human papillomavirus infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05202  Transcriptional misregulation in cancer
umr05203  Viral carcinogenesis
umr05206  MicroRNAs in cancer
umr05215  Prostate cancer
umr05220  Chronic myeloid leukemia
umr05222  Small cell lung cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103677760 (CDKN1B)
   04066 HIF-1 signaling pathway
    103677760 (CDKN1B)
   04068 FoxO signaling pathway
    103677760 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    103677760 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103677760 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103677760 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    103677760 (CDKN1B)
   05206 MicroRNAs in cancer
    103677760 (CDKN1B)
   05203 Viral carcinogenesis
    103677760 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    103677760 (CDKN1B)
   05220 Chronic myeloid leukemia
    103677760 (CDKN1B)
   05215 Prostate cancer
    103677760 (CDKN1B)
   05222 Small cell lung cancer
    103677760 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103677760 (CDKN1B)
   04934 Cushing syndrome
    103677760 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    103677760 (CDKN1B)
   05169 Epstein-Barr virus infection
    103677760 (CDKN1B)
   05165 Human papillomavirus infection
    103677760 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103677760 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103677760
NCBI-ProteinID: XP_008705224
UniProt: A0A384DEH6
LinkDB
Position
Un
AA seq 185 aa
MDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYE
WQEVEKGSLPEFYYRPPRPPKGVCKVPAQESQDVSGNRQAVPLIGSQANSEDTHLVDQKT
DTPDNQTGLAEQCTGIRKRPATDDSSPQNKRANRTEENVSDGSPNANAGSVEQTPKKPGL
RRRQT
NT seq 558 nt   +upstreamnt  +downstreamnt
atggacgccagacaggcggagtaccccaagccctccgcctgcagaaacctcttcggcccg
gtcaaccacgaagagttgacccgggacttggagaagcactgcagagacatggaagaggca
agccagcgcaagtggaattttgatttccagaatcacaagcccctggagggcaaatacgag
tggcaggaggtggagaagggcagcttgcccgagttctactacagacccccgcggccaccc
aaaggcgtctgcaaggtgccggcgcaggagagccaggacgtcagcgggaaccgccaggcg
gtgcctttaattgggtctcaggcaaactcagaggacacacatttggtagaccaaaagact
gatacgccggacaaccagaccgggttagcggagcagtgcaccgggataaggaagcgacct
gccacggacgattcctctcctcaaaacaaaagagccaacagaacagaagaaaatgtctca
gacggttccccgaacgcgaacgcgggttcagtggagcagacgcccaagaagccgggcctc
agaagacgtcaaacgtaa

DBGET integrated database retrieval system