KEGG   Ursus maritimus (polar bear): 103677917Help
Entry
103677917         CDS       T03271                                 

Gene name
TSPAN5
Definition
(RefSeq) tetraspanin 5
  KO
K17345  tetraspanin-5
Organism
umr  Ursus maritimus (polar bear)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103677917 (TSPAN5)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103677917 (TSPAN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 103677917
NCBI-ProteinID: XP_008705407
UniProt: A0A384DEG0
LinkDB All DBs
Position
Un
AA seq 268 aa AA seqDB search
MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGIAFLGIGLWAWNEKGVLSNISSITDLGGFD
PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK
DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC
GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF
IGIALLQIFGICLAQNLVSDIEAVRASW
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaagcactacaagggtcctgaagtcagttgttgcatcaaatatttcatattt
ggcttcaatgtcatattttggtttttgggaatagcatttcttggaattggactgtgggcg
tggaatgaaaaaggagttctgtccaacatctcttccatcaccgatctcggcggctttgac
ccggtttggctcttcctcgtggtgggaggagtgatgttcattttgggattcgcagggtgc
attggagcgctgcgggaaaacacgttccttctcaagttcttttctgtgttcctgggaatt
attttcttcctggagctcactgctggggttctggcatttgttttcaaagactggatcaaa
gaccagctgtatttctttataaacaacaacatcagagcgtacagagatgacattgatttg
cagaacctcatagacttcacgcaggaatattggcagtgctgtggggcttttggagctgat
gattggaacctaaatatttacttcaattgcacagattccaacgcaagtcgagagcgatgc
ggcgtgcccttctcctgctgcactaaggaccccgcggaagatgtcatcaacactcagtgt
ggctatgatgccaggcaaaaaccagaagttgaccagcagattgtaatctacacgaaaggc
tgtgtgccccagtttgagaagtggttgcaggacaatttaaccatcgtggctggtattttc
ataggcattgcattgctacagatttttgggatctgcctggctcagaatctggttagtgat
attgaagctgtcagggctagctggtag

DBGET integrated database retrieval system