KEGG   Ursus maritimus (polar bear): 103678785
Entry
103678785         CDS       T03271                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr04012  ErbB signaling pathway
umr04062  Chemokine signaling pathway
umr04110  Cell cycle
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04310  Wnt signaling pathway
umr04340  Hedgehog signaling pathway
umr04360  Axon guidance
umr04390  Hippo signaling pathway
umr04510  Focal adhesion
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04657  IL-17 signaling pathway
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04722  Neurotrophin signaling pathway
umr04728  Dopaminergic synapse
umr04910  Insulin signaling pathway
umr04916  Melanogenesis
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05135  Yersinia infection
umr05160  Hepatitis C
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05213  Endometrial cancer
umr05215  Prostate cancer
umr05217  Basal cell carcinoma
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103678785 (GSK3B)
   04310 Wnt signaling pathway
    103678785 (GSK3B)
   04340 Hedgehog signaling pathway
    103678785 (GSK3B)
   04390 Hippo signaling pathway
    103678785 (GSK3B)
   04151 PI3K-Akt signaling pathway
    103678785 (GSK3B)
   04150 mTOR signaling pathway
    103678785 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103678785 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103678785 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    103678785 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    103678785 (GSK3B)
   04657 IL-17 signaling pathway
    103678785 (GSK3B)
   04662 B cell receptor signaling pathway
    103678785 (GSK3B)
   04062 Chemokine signaling pathway
    103678785 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103678785 (GSK3B)
   04917 Prolactin signaling pathway
    103678785 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    103678785 (GSK3B)
   04919 Thyroid hormone signaling pathway
    103678785 (GSK3B)
   04916 Melanogenesis
    103678785 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    103678785 (GSK3B)
   04722 Neurotrophin signaling pathway
    103678785 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    103678785 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103678785 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103678785 (GSK3B)
   05225 Hepatocellular carcinoma
    103678785 (GSK3B)
   05226 Gastric cancer
    103678785 (GSK3B)
   05217 Basal cell carcinoma
    103678785 (GSK3B)
   05215 Prostate cancer
    103678785 (GSK3B)
   05213 Endometrial cancer
    103678785 (GSK3B)
   05224 Breast cancer
    103678785 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103678785 (GSK3B)
   05020 Prion disease
    103678785 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    103678785 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103678785 (GSK3B)
   04931 Insulin resistance
    103678785 (GSK3B)
   04934 Cushing syndrome
    103678785 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103678785 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103678785 (GSK3B)
   05162 Measles
    103678785 (GSK3B)
   05163 Human cytomegalovirus infection
    103678785 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103678785 (GSK3B)
   05165 Human papillomavirus infection
    103678785 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103678785 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103678785 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103678785 (GSK3B)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     103678785 (GSK3B)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   103678785 (GSK3B)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103678785 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 103678785
NCBI-ProteinID: XP_008706415
UniProt: A0A384DI01
LinkDB
Position
Un
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagataggccacaagaagtcagctatacagacactaaa
gtgattggaaatgggtcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattacaggacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatatgccaccgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctccagtatagatgta
tggtctgcaggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggac
agtggtgtggatcaattggtggaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaaccccaactacacagaattcaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cggacgccaccggaggcaattgcactgtgtagccgtctgctggagtatacaccaactgcc
cgattgacaccactggaagcttgtgcacattcattttttgatgaattaagggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaacccctacaaatgccacagcagcctcagatgctaatgccggagaccgtggacag
accaacaatgccgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system