KEGG   Ursus maritimus (polar bear): 103679064
Entry
103679064         CDS       T03271                                 

Gene name
MAP2K1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04114  Oocyte meiosis
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04218  Cellular senescence
umr04270  Vascular smooth muscle contraction
umr04370  VEGF signaling pathway
umr04371  Apelin signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04540  Gap junction
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04668  TNF signaling pathway
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04730  Long-term depression
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04912  GnRH signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04926  Relaxin signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05034  Alcoholism
umr05132  Salmonella infection
umr05135  Yersinia infection
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103679064 (MAP2K1)
   04012 ErbB signaling pathway
    103679064 (MAP2K1)
   04014 Ras signaling pathway
    103679064 (MAP2K1)
   04015 Rap1 signaling pathway
    103679064 (MAP2K1)
   04370 VEGF signaling pathway
    103679064 (MAP2K1)
   04371 Apelin signaling pathway
    103679064 (MAP2K1)
   04668 TNF signaling pathway
    103679064 (MAP2K1)
   04066 HIF-1 signaling pathway
    103679064 (MAP2K1)
   04068 FoxO signaling pathway
    103679064 (MAP2K1)
   04072 Phospholipase D signaling pathway
    103679064 (MAP2K1)
   04071 Sphingolipid signaling pathway
    103679064 (MAP2K1)
   04024 cAMP signaling pathway
    103679064 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    103679064 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    103679064 (MAP2K1)
   04150 mTOR signaling pathway
    103679064 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103679064 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103679064 (MAP2K1)
   04210 Apoptosis
    103679064 (MAP2K1)
   04218 Cellular senescence
    103679064 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103679064 (MAP2K1)
   04540 Gap junction
    103679064 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103679064 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103679064 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103679064 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    103679064 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    103679064 (MAP2K1)
   04660 T cell receptor signaling pathway
    103679064 (MAP2K1)
   04662 B cell receptor signaling pathway
    103679064 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    103679064 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    103679064 (MAP2K1)
   04062 Chemokine signaling pathway
    103679064 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103679064 (MAP2K1)
   04929 GnRH secretion
    103679064 (MAP2K1)
   04912 GnRH signaling pathway
    103679064 (MAP2K1)
   04915 Estrogen signaling pathway
    103679064 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    103679064 (MAP2K1)
   04917 Prolactin signaling pathway
    103679064 (MAP2K1)
   04921 Oxytocin signaling pathway
    103679064 (MAP2K1)
   04926 Relaxin signaling pathway
    103679064 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    103679064 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    103679064 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    103679064 (MAP2K1)
   04916 Melanogenesis
    103679064 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103679064 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    103679064 (MAP2K1)
   04726 Serotonergic synapse
    103679064 (MAP2K1)
   04720 Long-term potentiation
    103679064 (MAP2K1)
   04730 Long-term depression
    103679064 (MAP2K1)
   04722 Neurotrophin signaling pathway
    103679064 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103679064 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679064 (MAP2K1)
   05206 MicroRNAs in cancer
    103679064 (MAP2K1)
   05205 Proteoglycans in cancer
    103679064 (MAP2K1)
   05230 Central carbon metabolism in cancer
    103679064 (MAP2K1)
   05231 Choline metabolism in cancer
    103679064 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103679064 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103679064 (MAP2K1)
   05212 Pancreatic cancer
    103679064 (MAP2K1)
   05225 Hepatocellular carcinoma
    103679064 (MAP2K1)
   05226 Gastric cancer
    103679064 (MAP2K1)
   05214 Glioma
    103679064 (MAP2K1)
   05216 Thyroid cancer
    103679064 (MAP2K1)
   05221 Acute myeloid leukemia
    103679064 (MAP2K1)
   05220 Chronic myeloid leukemia
    103679064 (MAP2K1)
   05218 Melanoma
    103679064 (MAP2K1)
   05211 Renal cell carcinoma
    103679064 (MAP2K1)
   05219 Bladder cancer
    103679064 (MAP2K1)
   05215 Prostate cancer
    103679064 (MAP2K1)
   05213 Endometrial cancer
    103679064 (MAP2K1)
   05224 Breast cancer
    103679064 (MAP2K1)
   05223 Non-small cell lung cancer
    103679064 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103679064 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    103679064 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    103679064 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103679064 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103679064 (MAP2K1)
   05135 Yersinia infection
    103679064 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103679064 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    103679064 (MAP2K1)
   05161 Hepatitis B
    103679064 (MAP2K1)
   05160 Hepatitis C
    103679064 (MAP2K1)
   05164 Influenza A
    103679064 (MAP2K1)
   05163 Human cytomegalovirus infection
    103679064 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103679064 (MAP2K1)
   05165 Human papillomavirus infection
    103679064 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103679064 (MAP2K1)
   01522 Endocrine resistance
    103679064 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103679064 (MAP2K1)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103679064 (MAP2K1)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: STE group
  STE7 family
   103679064 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 103679064
NCBI-ProteinID: XP_008706781
UniProt: A0A384DIG4
LinkDB
Position
Un
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDGEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aacgggaccagctcggcggagaccaacctggaggccttgcagaagaagctggaggagctg
gagctcgatgagcagcagcggaagcgcctggaggccttcctcacccagaagcagaaggtc
ggggaattgaaggatgacgactttgagaagatcagtgagctgggcgctggcaacggtggt
gtggtgttcaaggtctcccacaagccctccggcctggtcatggccagaaagctaattcac
ctggagatcaaacctgcaatccggaatcagatcataagagagctgcaggttctgcacgag
tgcaactcgccttacattgtgggcttctatggtgcgttctacagcgatggcgagatcagt
atctgcatggaacatatggatgggggttccttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggtctgacttacctg
agggagaagcacaagattatgcacagagatgtcaagccttccaacatcctcgtgaactcc
cgtggggagatcaagctctgtgactttggggtcagtgggcagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcggtggggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaagtggag
ggagatgcggctgagacgccacccagaccaaggacccccggaaggcccctcagctcttac
ggaatggacagccggcctcccatggcgatttttgagttgctggattacatagtcaacgag
cctcctccaaaactgcccagtggagttttcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccccgcagagagagcagatctgaagcaactcatggttcatgccttc
atcaagagatcggacggggaagaagtggattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacaccgacccacgcagccggcgtctaa

KEGG   Ursus maritimus (polar bear): 103681834
Entry
103681834         CDS       T03271                                 

Gene name
MAP2K2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04218  Cellular senescence
umr04270  Vascular smooth muscle contraction
umr04370  VEGF signaling pathway
umr04371  Apelin signaling pathway
umr04540  Gap junction
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04730  Long-term depression
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04926  Relaxin signaling pathway
umr04929  GnRH secretion
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05135  Yersinia infection
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103681834 (MAP2K2)
   04012 ErbB signaling pathway
    103681834 (MAP2K2)
   04014 Ras signaling pathway
    103681834 (MAP2K2)
   04015 Rap1 signaling pathway
    103681834 (MAP2K2)
   04370 VEGF signaling pathway
    103681834 (MAP2K2)
   04371 Apelin signaling pathway
    103681834 (MAP2K2)
   04066 HIF-1 signaling pathway
    103681834 (MAP2K2)
   04068 FoxO signaling pathway
    103681834 (MAP2K2)
   04072 Phospholipase D signaling pathway
    103681834 (MAP2K2)
   04071 Sphingolipid signaling pathway
    103681834 (MAP2K2)
   04024 cAMP signaling pathway
    103681834 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    103681834 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    103681834 (MAP2K2)
   04150 mTOR signaling pathway
    103681834 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103681834 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    103681834 (MAP2K2)
   04218 Cellular senescence
    103681834 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103681834 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    103681834 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103681834 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103681834 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    103681834 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    103681834 (MAP2K2)
   04660 T cell receptor signaling pathway
    103681834 (MAP2K2)
   04662 B cell receptor signaling pathway
    103681834 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    103681834 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103681834 (MAP2K2)
   04929 GnRH secretion
    103681834 (MAP2K2)
   04912 GnRH signaling pathway
    103681834 (MAP2K2)
   04915 Estrogen signaling pathway
    103681834 (MAP2K2)
   04917 Prolactin signaling pathway
    103681834 (MAP2K2)
   04921 Oxytocin signaling pathway
    103681834 (MAP2K2)
   04926 Relaxin signaling pathway
    103681834 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    103681834 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    103681834 (MAP2K2)
   04916 Melanogenesis
    103681834 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103681834 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    103681834 (MAP2K2)
   04730 Long-term depression
    103681834 (MAP2K2)
   04722 Neurotrophin signaling pathway
    103681834 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103681834 (MAP2K2)
   05206 MicroRNAs in cancer
    103681834 (MAP2K2)
   05205 Proteoglycans in cancer
    103681834 (MAP2K2)
   05230 Central carbon metabolism in cancer
    103681834 (MAP2K2)
   05231 Choline metabolism in cancer
    103681834 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103681834 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103681834 (MAP2K2)
   05225 Hepatocellular carcinoma
    103681834 (MAP2K2)
   05226 Gastric cancer
    103681834 (MAP2K2)
   05214 Glioma
    103681834 (MAP2K2)
   05216 Thyroid cancer
    103681834 (MAP2K2)
   05221 Acute myeloid leukemia
    103681834 (MAP2K2)
   05220 Chronic myeloid leukemia
    103681834 (MAP2K2)
   05218 Melanoma
    103681834 (MAP2K2)
   05211 Renal cell carcinoma
    103681834 (MAP2K2)
   05219 Bladder cancer
    103681834 (MAP2K2)
   05215 Prostate cancer
    103681834 (MAP2K2)
   05213 Endometrial cancer
    103681834 (MAP2K2)
   05224 Breast cancer
    103681834 (MAP2K2)
   05223 Non-small cell lung cancer
    103681834 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103681834 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    103681834 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103681834 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103681834 (MAP2K2)
   05135 Yersinia infection
    103681834 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103681834 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    103681834 (MAP2K2)
   05161 Hepatitis B
    103681834 (MAP2K2)
   05160 Hepatitis C
    103681834 (MAP2K2)
   05164 Influenza A
    103681834 (MAP2K2)
   05163 Human cytomegalovirus infection
    103681834 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103681834 (MAP2K2)
   05165 Human papillomavirus infection
    103681834 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103681834 (MAP2K2)
   01522 Endocrine resistance
    103681834 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103681834 (MAP2K2)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103681834 (MAP2K2)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: STE group
  STE7 family
   103681834 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 103681834
NCBI-ProteinID: XP_008709638
UniProt: A0A384DRM3
LinkDB
Position
Un
AA seq 386 aa
PTSEGASEANLVDLQKKLAELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNG
GVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEI
SICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVN
SRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELSIG
RYPIPPPDAKELEAIFGRPVVDGVEGEPHSISPRPRPPGRPISGHGTDSLPAMAIFELLD
YIVNEPPPKLPSGVFTQDFQEFVNKCLIKNPAERADLKMLMVSDPGGSGSPRGEGRPQPS
SQLCCPGPHVMLESPCGLLAPLVGRV
NT seq 1161 nt   +upstreamnt  +downstreamnt
cccaccagcgagggcgcctccgaagcaaacttggtggacctccaaaagaagctagcagag
ctagaactcgacgagcagcagaagaagcgactggaagccttcctcacccagaaggccaag
gttggggagctcaaggacgatgacttcgaacggatctcggagctgggagccgggaacggc
ggggtggtcaccaaggtccagcacagaccttccggcctcatcatggcgagaaagctgatc
cacctggaaatcaagccggccatccggaaccagatcatccgcgagctgcaggtgctgcac
gagtgtaactcgccgtacatcgtgggcttctacggggccttctacagcgacggcgagatc
agcatctgcatggagcacatggacggcggctctctggaccaggtgttgaaagaagccaag
agaattcccgaggagatcctggggaaggtcagcattgcggttctccggggtttggcgtat
ctccgggaaaagcaccagatcatgcaccgagacgtgaaaccttccaacatcctcgtcaac
tcccgaggggagattaagctgtgcgattttggggtgagcggacagctcattgactccatg
gccaactccttcgtggggacccggtcctacatgtctccagagcggttgcagggcactcac
tactctgtgcagtcggacatctggagcatgggcctgtccctggtggagctgtccatcgga
aggtaccccatccccccgccggacgccaaggagctagaggccatatttggccggcccgtg
gtggacggggtagaaggagagcctcacagcatctcaccacggccgagaccccctggacgc
cccattagcggtcacgggacggacagcctgccggccatggccatcttcgagctgctggac
tatatcgtgaacgagccacctcccaagctgcccagtggcgtcttcacccaggacttccag
gagtttgtaaataaatgcctaataaagaacccagcagagcgagcggatctgaagatgctc
atggtaagtgatcctgggggctctggctcacctcggggagagggtagaccccagccctca
agccagctctgctgtcctgggccccatgtcatgctggagagcccctgtggtctcctggct
ccattagtgggaagggtctag

DBGET integrated database retrieval system