KEGG   Ursus maritimus (polar bear): 103679246Help
Entry
103679246         CDS       T03271                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00020  Citrate cycle (TCA cycle)
umr00190  Oxidative phosphorylation
umr01100  Metabolic pathways
umr01200  Carbon metabolism
umr04714  Thermogenesis
umr04932  Non-alcoholic fatty liver disease (NAFLD)
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103679246 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103679246 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103679246 (SDHA)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    103679246 (SDHA)
   05012 Parkinson disease
    103679246 (SDHA)
   05016 Huntington disease
    103679246 (SDHA)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103679246 (SDHA)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103679246 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 103679246
NCBI-ProteinID: XP_008706975
LinkDB All DBs
Position
Un
AA seq 658 aa AA seqDB search
SQNRALFGESVDLAQWPTTRQTGTCGFHFTVDGNKRSSAKVSNSISTQYPVVDHEFDAVV
VGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDT
VKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLKFGKGGQA
HRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHR
IRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCL
ITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYL
QLHHLPPEQLAIRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVN
GQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVPPIKP
NAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKISQLYGDL
KHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKERIDEYDY
SKPIQGQQKKPFEEHWRKHTLSYVDVKTGKVSLEYRPVIDKTLNEADCATVPPAIRSY
NT seq 1979 nt NT seq  +upstreamnt  +downstreamnt
gttcgcagaaccgagccctcttcggggaaagcgtagacctggcacagtggccaacgacaa
ggcagacgggcacctgcggttttcacttcactgttgatgggaataagaggtcttctgcga
aagtttccaattcaatttctacgcagtacccagtagtggaccatgagtttgatgcggtgg
tggtaggtgctggaggggcaggcctgcgagctgcgtttggcctttccgaggctgggttta
acacggcctgtgtcacaaagctctttcctaccagatcacacaccgttgcagcccagggag
gaatcaatgctgctctggggaacatggaggaagacaactggagatggcacttctacgaca
ccgtgaagggctccgactggctgggggaccaggacgccatccactacatgacagagcagg
cacctgcttccgtggtagagctggagaattatggcatgccatttagcagaactgaagatg
ggaggatttaccagcgtgcttttggcggacagagcctcaagtttgggaaaggcgggcagg
cccaccggtgctgctgtgtggctgaccgcaccggccactcactgctgcacacgttgtatg
gaaggtctctgcgatatgataccagctattttgtagagtattttgccttggatctcctga
tggaaaatggggagtgtcgtggtgttattgcactatgcatagaggatgggtccatccatc
gcataagagccaagaacactgttgtagctaccggaggctacgggcgtacctacttcagct
gcacatccgcccacaccagcaccggtgatggcaccgccatggtcaccagggcaggccttc
cctgccaggacttggagtttgttcagttccaccccacaggtatatatggtgctggttgtc
tcattacggaaggatgccgtggagagggaggcattctcattaacagccaaggtgaaaggt
tcatggagcgatatgccccagtcgcaaaggacctggcgtccagagacgttgtgtctcggt
ccatgactctggaaatccgtgaaggaagaggctgtggccctgagaaagatcacgtctacc
tgcagttgcaccacctaccccccgagcagctggccatacgcctgcctggcatttcagaga
cggccatgatcttcgcaggcgtggatgtcaccaaggagccgatccctgtccttcccactg
tgcactataacatgggcggtattcccaccaactacaaggggcaggttctgaggcatgtga
atggccaggatcagatcgtgcccggcctgtatgcctgtggggaggccgcctgtgcctcag
tgcacggtgccaaccgtctcggggcaaactcgctcttggacctggtcgtcttcggccggg
cgtgtgccctgagtattgcagagtcctgcagacccggagataaagttcccccaattaaac
caaatgctggggaagagtctgttatgaatcttgacaaattgagatttgctgatggaagca
taagaacatcagaactacgactcagcatgcagaagtcgatgcaaagtcatgccgcagtgt
ttcgtgtgggaagtgtgttacaggaaggatgtgagaaaatcagccagctctatggagacc
taaaacatctgaagacgtttgaccgaggaatggtctggaacaccgacctggtggagaccc
tggagctgcagaacctgatgctctgtgcacttcagaccatttatggagcagaggcccgga
aggagtctcgtggtgctcatgccagggaagattacaaggagcggattgacgagtatgatt
actccaagcccattcaggggcagcagaagaagccatttgaggagcactggaggaagcaca
ccctttcctatgttgatgtcaagactgggaaggtttcattggaatacagaccagtgatcg
acaaaactttaaatgaggctgactgtgccacagtccctccagccattcgctcctactga

DBGET integrated database retrieval system