KEGG   Ursus maritimus (polar bear): 103679263
Entry
103679263         CDS       T03271                                 

Gene name
TERT
Definition
(RefSeq) telomerase reverse transcriptase
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05200  Pathways in cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679263 (TERT)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103679263 (TERT)
   05226 Gastric cancer
    103679263 (TERT)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103679263 (TERT)
   05165 Human papillomavirus infection
    103679263 (TERT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:umr03032]
    103679263 (TERT)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     103679263 (TERT)
DNA replication proteins [BR:umr03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    103679263 (TERT)
   Telomerase complex (fungi)
    103679263 (TERT)
SSDB
Motif
Pfam: Telomerase_RBD RVT_1
Other DBs
NCBI-GeneID: 103679263
NCBI-ProteinID: XP_008706990
UniProt: A0A384DJM4
LinkDB
Position
Un
AA seq 794 aa
MRGSLRFPPLAKRPRRGETPEPDLGTDRPSTRAHLGRAYGPSDSKPRAVTPGRAAAEASS
WEGGPPGTRRTSPAAQPSQGPQGVPHHPAHPETKHFLYSSGGRERLRPSFLLSALPPSLT
GARKLVETIFLGSKPGRPGAARRSRRLPARYWRMRPLFRELLGNHARCPYGALLRTHCPL
RVAAAGEASSNRECRGVGVCPLERPAAAPEESTDPGRLVHLLRQHSSPWQVYAFLRACLC
RLVPAGLWGSRHNQHRFLRNVKKFISLGKHAKLSLQELTWKMKVQDCAWLHGSPGARCVP
AAEHRRREEVLATFLCWLMGTYVVELLRSFFYVTETTFQKNRLFFYRKTVWSQLQSIGIR
QHFTSVHLRELSAAEVRRHHEARGTLLTSRLRFLPKRSGLRPIVNMDYVVGARTFRRDKK
VQHLTSQVKTLFSVLNYERARRPSLLGASVLGMDDIHRAWRAFVLRVRAQDPAPQLYFVK
VDVTGAYDALPQDRLVEVIANVIRPQENTYCVRQYAVVRRTAQGHIRKSFKRHVSTFADL
QPYMRHFVEHLQETSSLRDAVVIEQSSSLNEAGSGLFHLFLRLVYNHVIRIGGKSYVQCQ
GIPQGSILSTLLCSLCYGDMESRLFPGIQQDGVLLRLVDDFLLVTPHLTQARAFLRTLVR
GVPEYGCTANLQKTAVNFPVEDIALGSAAPLQLPAHCLFPWCGLLLDTRTLEVSCDYSRF
HACVLQFPFNQPVRKNPSFFLRVIADTASHCYSLLKAKNTAKAQLCRQLPGVTLAALEAA
ADPSLTADFKTILD
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgcgggggagcctgcgttttccgcctctggccaagagacccagacgcggcgagacgcca
gagccggacctggggaccgacaggccgtctacccgggcccacctgggcagggcctatggg
ccgagtgacagcaagcctcgcgcagtgacacctggcagggccgctgcagaagcttcctct
tgggagggagggccccctgggactcgtcgcacctccccggccgcacagccatctcagggg
ccccagggagtaccccatcacccagcgcaccccgagaccaagcacttcctctacagctcg
ggaggcagggagcggctgcgcccctccttcctgctcagtgccctgccgcctagcctgacc
ggggcccggaaactcgtggagaccatctttctgggctccaagcccgggaggccgggggct
gcccgcaggtcgcgccgcctgcccgcgcgctactggcggatgaggcccctgttccgggag
ctgcttgggaaccacgcgcggtgcccgtacggggcgctcctcaggacccactgcccgctc
cgggtggcggccgctggggaggcgtccagcaaccgcgagtgcagaggagtgggcgtgtgc
ccgttggagaggccagcggcagcccccgaggagagcacggaccccgggcgcctggtccac
cttctccggcagcacagcagtccctggcaggtgtatgctttcctgcgggcctgcctgtgc
cggctggtgcccgctggactctggggctccaggcacaaccagcaccgcttcttaaggaac
gtgaagaagttcatctctctgggaaagcacgccaagctctcgctgcaggagctgacgtgg
aagatgaaagtgcaggactgcgcctggctgcacgggagcccaggggctcgctgtgtcccg
gccgccgagcaccgtcgcagggaggaggtcctggccacgttcctgtgctggctgatgggc
acgtacgtggttgagctgctcaggtcgtttttttatgtcacggaaaccacgtttcagaag
aaccggctcttcttctaccggaagaccgtgtggagccagttacagagtataggaatcaga
cagcacttcaccagcgtgcatctccgagaactgtccgcagcagaggtcagaagacaccat
gaagccagaggaactctcctaacatcccgactccgcttcctccccaagcgcagtgggctg
cggcccattgtgaacatggactacgtggtgggagccagaacgttccgcagagacaagaag
gtccagcatctcacctcgcaagtgaagacactgttcagcgtgctgaactacgagcgggcc
cggcgccccagcctcctgggggcctccgtgctgggtatggacgacatccacagggcctgg
cgagcctttgtgctgcgcgtgcgggcccaggacccagcaccccagctgtactttgtcaag
gtggacgtgacgggggcgtatgatgccctcccccaggacaggctggtagaggtcattgcc
aacgtgatcaggcctcaagaaaacacctactgcgtgcgccagtatgccgtggtccggaga
actgcccagggacacatccgcaagtccttcaaaagacacgtgtccaccttcgcagacctc
cagccgtacatgaggcacttcgtggagcatctgcaagagaccagctcactgagggacgct
gtggtcattgagcagagctcctctctgaacgaagccggcagcggccttttccacctcttc
ctgcgcctggtgtacaaccacgtcataaggatcgggggcaagtcgtacgtccagtgtcag
gggatcccccagggctccatcctgtccactctgctgtgcagtctctgctacggggacatg
gagagcaggttgtttcctggaatccagcaggacggggtgctgctgcgcctggtggacgac
tttctgctggtcacacctcacctgacgcaagcgcgggcctttctcaggaccctggtcaga
ggtgttcccgagtacggctgcacagccaacttgcagaagacggcagtgaacttccctgtg
gaggacatcgccctgggcagcgcggcccccctccagctgccagcccactgcctgttcccc
tggtgcggcttgctgctggacacccggaccctggaggtgtcctgtgactactccaggttc
cacgcatgtgtgctccagtttccgttcaaccagccggtgaggaagaacccctccttcttc
ctccgtgtcatcgcggacaccgcgtcgcactgctactccctcctgaaagccaagaacaca
gccaaagcgcagctgtgccgtcagctcccgggggtgactctggccgccctggaggcagcg
gctgaccccagcctgaccgcagacttcaagaccattttggactga

DBGET integrated database retrieval system