KEGG   Ursus maritimus (polar bear): 103679423
Entry
103679423         CDS       T03271                                 

Gene name
BAD
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04140  Autophagy - animal
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04370  VEGF signaling pathway
umr04510  Focal adhesion
umr04722  Neurotrophin signaling pathway
umr04910  Insulin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr05010  Alzheimer disease
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05165  Human papillomavirus infection
umr05168  Herpes simplex virus 1 infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05215  Prostate cancer
umr05218  Melanoma
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05223  Non-small cell lung cancer
umr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103679423 (BAD)
   04014 Ras signaling pathway
    103679423 (BAD)
   04370 VEGF signaling pathway
    103679423 (BAD)
   04024 cAMP signaling pathway
    103679423 (BAD)
   04022 cGMP-PKG signaling pathway
    103679423 (BAD)
   04151 PI3K-Akt signaling pathway
    103679423 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103679423 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    103679423 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103679423 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103679423 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103679423 (BAD)
   04919 Thyroid hormone signaling pathway
    103679423 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103679423 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679423 (BAD)
   05203 Viral carcinogenesis
    103679423 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103679423 (BAD)
   05212 Pancreatic cancer
    103679423 (BAD)
   05225 Hepatocellular carcinoma
    103679423 (BAD)
   05221 Acute myeloid leukemia
    103679423 (BAD)
   05220 Chronic myeloid leukemia
    103679423 (BAD)
   05218 Melanoma
    103679423 (BAD)
   05211 Renal cell carcinoma
    103679423 (BAD)
   05215 Prostate cancer
    103679423 (BAD)
   05213 Endometrial cancer
    103679423 (BAD)
   05223 Non-small cell lung cancer
    103679423 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103679423 (BAD)
   05014 Amyotrophic lateral sclerosis
    103679423 (BAD)
   05020 Prion disease
    103679423 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    103679423 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103679423 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103679423 (BAD)
   05161 Hepatitis B
    103679423 (BAD)
   05160 Hepatitis C
    103679423 (BAD)
   05162 Measles
    103679423 (BAD)
   05168 Herpes simplex virus 1 infection
    103679423 (BAD)
   05165 Human papillomavirus infection
    103679423 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103679423 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103679423 (BAD)
   01524 Platinum drug resistance
    103679423 (BAD)
   01522 Endocrine resistance
    103679423 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 103679423
NCBI-ProteinID: XP_008707189
UniProt: A0A384DJL2
LinkDB
Position
Un
AA seq 168 aa
MFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGPGKHRQTAPGLLGEAAHPQGQPASSNH
HGGAGAVEPRSRHSSYPAGTEEDEGLEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSD
EFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcccagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggaccagcccccaggccctggcaagcaccggcagaca
gccccaggcctcctaggggaagctgctcacccccaggggcagccggccagcagcaaccac
catggaggcgctggggctgtggagccccggagtcgccacagctcgtaccccgcggggacc
gaagaggatgaagggttggaggaggaagagctcagccctttccgggggcgctcgagctca
gcgccccccaacctctgtgctgcactgcgctatggccgcgagctccggaggatgagcgac
gagttccagggctccttcaagggacttcctcgcccgaagagcgcgggcacagcgacgcag
atgcgacaaagccccagctggacgcgcgtcatccagtcctggtgggatcggaacttgggg
agaggaggctccgccccctcccaatga

DBGET integrated database retrieval system