KEGG   Ursus maritimus (polar bear): 103679475
Entry
103679475         CDS       T03271                                 

Gene name
FOSL1
Definition
(RefSeq) FOS like 1, AP-1 transcription factor subunit
  KO
K04502  fos-like antigen 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04310  Wnt signaling pathway
umr04380  Osteoclast differentiation
umr04657  IL-17 signaling pathway
umr05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103679475 (FOSL1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    103679475 (FOSL1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103679475 (FOSL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103679475 (FOSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103679475 (FOSL1)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    103679475 (FOSL1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 Macoilin HALZ TMCO5 UPF0242 DUF4407 DUF4527
Other DBs
NCBI-GeneID: 103679475
NCBI-ProteinID: XP_008707240
UniProt: A0A384DKC2
LinkDB
Position
Un
AA seq 302 aa
MRLAQSHTAHKQGFVTRSVSLSRCLWEPAAALRVDGSVASVQGKPSVYTDLTLGSPFLDP
QKFHPVPSIHAVSGSQELQWMVQPHFLGPSSYPRPLAYPQYSPPQPRPGVIRALGPHPGV
RRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSSLQREIE
ELQKQKERLELVLEAHRPICKIPEGATESDTGGTGGTSGTSSPPAPSRPVPCISLSSGSV
LEPEALHTPTLMTTPSLTPFTPSPVFTYPSTPEPCSSAHRRSSSSSGDPSSDPLGSPTLL
AL
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaggcttgcccaaagtcacacagctcataagcagggatttgtcaccaggtcagtgtct
ctgtcaaggtgtctctgggaaccagcagctgcattgagggtggatggcagtgtggcttct
gtccaggggaagccctcagtctacacagacctcacccttggctctccatttcttgaccct
cagaagttccaccccgtgccgagcatccacgctgtgagtggcagccaggagctacagtgg
atggtgcagcctcacttcctgggacccagcagttaccccaggcctctggcctacccccag
tacagccccccgcagccccggccaggagtcatccgggccctagggccacatccaggggtg
cgtcgccgaccctgtgaacagatcagcccggaggaggaggagcgccgtcgagtgaggcgt
gagcggaataagctggccgcggccaagtgcaggaaccggaggaaggaactgaccgacttc
ctgcaggcggagactgacaaactggaggacgagaaatccagtctgcaacgagagattgag
gagctgcagaagcagaaggagcgcctggagctggtccttgaagcccaccgccccatctgc
aaaatcccggaaggggccacggagagcgacactggcggcacgggcggtaccagcggcacc
agcagcccaccagccccctcccgccctgtaccttgtatctctctttcctcggggtctgtg
cttgaacccgaagcattgcacaccccgacgctcatgaccacaccctccctgactcctttc
acccctagtcccgtcttcacctaccccagcacccctgagccctgctcctcagcccatcgc
aggagtagcagcagcagcggggacccatcctctgaccctctcggctcccctaccctcctt
gccttatga

DBGET integrated database retrieval system