KEGG   Ursus maritimus (polar bear): 103679527Help
Entry
103679527         CDS       T03271                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103679527
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103679527
Enzymes [BR:umr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103679527
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103679527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3970
Motif
Other DBs
NCBI-GeneID: 103679527
NCBI-ProteinID: XP_008707309
LinkDB All DBs
Position
Un
AA seq 396 aa AA seqDB search
MKWLGESKNMVVNGRRSGGKLSNDHQQNQSKLQHAGKEATKAGKHAVERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFP
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNARSSYV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggaggagtggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaaattgcagcacgcgggaaaggaggccacg
aaggctggcaagcacgcagttgagaggaggtcaagcagatgtaatggtaattcgggattt
gaaggacagagtcgatatgtaccatcttctggaatgtctgccaaggagctctgtgagaat
gatgacctggcgaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaatctgacagttttcct
cacaacaaccctgtgagatttcggcctattaagggaaggcaagaagaactgaaggaggtc
attgaacgttttaagaaagatgaacacttggagaaggccttcaaatgtttgacttcaggc
gaatgggcacggcattattttctcaacaagaacaaaatgcaggagaaattattcaaggaa
catgtatttatctacttgcgaatgtttgcaactgacagtggatttgagatattgccttgt
aatagatactcatctgaacaaaatggagccaaaatagttgcgacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacacggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcagctctggcttggccccgccgcctttataaaccatgattgcagacctaactgcaag
tttgtgtcaactggtcgagatacggcgtgtgtgaaggccctgagagacattgagcctgga
gaagagatttcttgttactacggagacgggttttttggagaaaataatgagttctgcgag
tgttacacttgcgaaagacggggaaccggtgcttttaaatccagagtgggactgcctgca
cctgctcctgttatcaatagcaaatacggactcagagaaacagataaacgcttaaatagg
cttaaaaagttaggtgacagcagcaaaaactcagacagtcaatctgtcagctctaacact
gatgcagataccactcaggaaaaaaacaatgcaaggtcgtcctatgtttga

DBGET integrated database retrieval system