KEGG   Ursus maritimus (polar bear): 103679680
Entry
103679680         CDS       T03271                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01523  Antifolate resistance
umr04010  MAPK signaling pathway
umr04014  Ras signaling pathway
umr04062  Chemokine signaling pathway
umr04064  NF-kappa B signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04380  Osteoclast differentiation
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04623  Cytosolic DNA-sensing pathway
umr04625  C-type lectin receptor signaling pathway
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04668  TNF signaling pathway
umr04920  Adipocytokine signaling pathway
umr05132  Salmonella infection
umr05135  Yersinia infection
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05212  Pancreatic cancer
umr05215  Prostate cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05222  Small cell lung cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05340  Primary immunodeficiency
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103679680 (IKBKG)
   04014 Ras signaling pathway
    103679680 (IKBKG)
   04064 NF-kappa B signaling pathway
    103679680 (IKBKG)
   04668 TNF signaling pathway
    103679680 (IKBKG)
   04151 PI3K-Akt signaling pathway
    103679680 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103679680 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103679680 (IKBKG)
   04621 NOD-like receptor signaling pathway
    103679680 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    103679680 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    103679680 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    103679680 (IKBKG)
   04660 T cell receptor signaling pathway
    103679680 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    103679680 (IKBKG)
   04659 Th17 cell differentiation
    103679680 (IKBKG)
   04657 IL-17 signaling pathway
    103679680 (IKBKG)
   04662 B cell receptor signaling pathway
    103679680 (IKBKG)
   04062 Chemokine signaling pathway
    103679680 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103679680 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103679680 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103679680 (IKBKG)
   05203 Viral carcinogenesis
    103679680 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103679680 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103679680 (IKBKG)
   05221 Acute myeloid leukemia
    103679680 (IKBKG)
   05220 Chronic myeloid leukemia
    103679680 (IKBKG)
   05215 Prostate cancer
    103679680 (IKBKG)
   05222 Small cell lung cancer
    103679680 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    103679680 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103679680 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103679680 (IKBKG)
   05135 Yersinia infection
    103679680 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103679680 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    103679680 (IKBKG)
   05162 Measles
    103679680 (IKBKG)
   05164 Influenza A
    103679680 (IKBKG)
   05161 Hepatitis B
    103679680 (IKBKG)
   05160 Hepatitis C
    103679680 (IKBKG)
   05168 Herpes simplex virus 1 infection
    103679680 (IKBKG)
   05163 Human cytomegalovirus infection
    103679680 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103679680 (IKBKG)
   05169 Epstein-Barr virus infection
    103679680 (IKBKG)
   05165 Human papillomavirus infection
    103679680 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103679680 (IKBKG)
   05142 Chagas disease
    103679680 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103679680 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103679680 (IKBKG)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103679680 (IKBKG)
SSDB
Motif
Pfam: NEMO zf_C2H2_10 CC2-LZ zf_C2H2_ZHX Bacillus_HBL
Other DBs
NCBI-GeneID: 103679680
NCBI-ProteinID: XP_008707464
UniProt: A0A384DL06
LinkDB
Position
Un
AA seq 344 aa
MFRDIFCSSKLTEFETLICWMSRPPWKSQLCEMVQPSGGPAGDQEVLGEESSLGKPAMLH
LPSEQGTPETFQRCLEENQELRDAIRQSNQMLRERCEELQRFQGSQRKEKEFLMQKFQEA
RKLVERLSLEKLDLRRQREQALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRL
EAATKERQALEGRRKLAQLQVAYHQLFQEYDNHIKSSMVSSERNRGMQLEDLKLQLQQAE
EALVAKQEVIDKLKEEAEQHKMVMETVPVLKAQADIYKADFQSYQVSVLSATCPLSPAHP
SFHLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgttccgagacattttctgttcatcaaagttgactgaatttgagaccctgatttgttgg
atgagcaggcccccctggaagagtcagctgtgtgagatggtgcagcccagtggtggcccg
gcaggggaccaggaagtgctgggtgaagaatcttctctggggaagccagctatgctccac
ctaccttctgagcagggcactcctgagaccttccaacgctgtctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgcttcgggagcgctgtgaggaactgcag
cgtttccaaggcagccagaggaaggagaaggagttcctcatgcagaaattccaagaagcc
aggaaactggtagaaagactgagcctggagaaactcgacctgaggaggcagagggagcag
gccctgcaggaggtggaacatctgaagagatgccagcagcagatggctgaggacaaggcc
tccgtgaaagcccaggtgacatccttgctgggggagctccaagagagccagagtcgtttg
gaggctgccaccaaggagcggcaggctttggagggcaggcggaagctggcccagctacag
gtggcctatcaccagctcttccaagagtatgacaaccacatcaagagcagcatggtgagc
agtgagcgaaaccgaggaatgcagctggaggatctcaagctgcagctccagcaggccgag
gaggccctggtggccaagcaggaagtgattgacaagctgaaggaagaggctgagcagcac
aagatggtgatggagactgtcccggtgctaaaggctcaggcggatatctacaaggcagac
ttccagtcctatcaagtctcagtactttctgccacctgccctctttctccagctcaccct
tcctttcacctggccctgcccagccagaggagaagcccgcccgaggagccacctgacttc
tgttgccccaagtgccagtatcaggctcctgatatggacaccctgcagatacatgtcatg
gagtgcatcgagtag

DBGET integrated database retrieval system