KEGG   Ursus maritimus (polar bear): 103680847
Entry
103680847         CDS       T03271                                 

Gene name
MLH1
Definition
(RefSeq) mutL homolog 1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr03430  Mismatch repair
umr03460  Fanconi anemia pathway
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05213  Endometrial cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    103680847 (MLH1)
   03460 Fanconi anemia pathway
    103680847 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103680847 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103680847 (MLH1)
   05226 Gastric cancer
    103680847 (MLH1)
   05213 Endometrial cancer
    103680847 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103680847 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:umr03400]
    103680847 (MLH1)
DNA repair and recombination proteins [BR:umr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     103680847 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 103680847
NCBI-ProteinID: XP_008708566
UniProt: A0A384DNG4
LinkDB
Position
Un
AA seq 757 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
DAKCAYRANYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVADVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLDISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGSSVEVV
KSTTGVTPSSTGSGDKVYAHQMVRTDSREQKLDAFLQPMSKALSSQPQAIVPEDRTDASS
GGAGQQDEEMLELPEPAQVAATNQGTEVDVTEGTSETSEKRGPSSSPGNPRKRPRESSDV
EMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINERGHETLREMLHNHSFVGCVNPQWA
LAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTE
EDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILR
LATEVNWDEEKECFESLSKECAIFYSIRKQYISEESTLSGQQSEVSGSSAKPWKWTVEHI
VYKAFRSHLLPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgtcgctcgtagcgggggttattcggcggttggacgagacagtggtgaaccgcatcgcg
gcaggggaagttatccagcggccggctaatgccatcaaggagatgattgagaactgttta
gatgcaaaatccaccagtatccaagtggttgttaaagagggaggcctcaagttgattcag
atccaagacaatggcactgggatcaggaaagaagatctggatattgtgtgtgagaggttc
actacaagtaaactgcagtcctttgaggatttagctagtatttctacctatggctttcgg
ggtgaggctttagccagcatcagccacgtggctcatgttactattacaaccaaaacagct
gatgcaaagtgcgcctacagagcaaattattcagatggaaagctgaaagctcctcctaaa
ccatgtgcaggcaatcaggggacccagatcacggtagaggaccttttttacaacatatcc
acgaggaggaaagctttaaaaaatccaagtgaagaatatgggaaaatattggaagttgtt
ggcaggtattcaatacataattcaggcattagtttctcagttaaaaaacaaggtgagacc
gtagctgacgttaggacactgcctaatgccacaacggtggacaatattcgctccatcttt
ggaaatgctgttagccgagaactgatagaagttgggtgtgaggataaaaccctagccttc
aaaatgaatggctacatatccaatgcaaattactcggtaaagaagtgcatcttcttactc
ttcatcaaccatcgtctggtagagtcaacttccttaagaaaagccattgaaacagtgtat
gcagcatatttgcccaaaaacacacacccattcctgtacctcagcttagacatcagcccc
cagaacgtggacgtcaatgtacaccccacaaagcatgaagttcacttcctgcacgaggac
agcatcctggagcgggtgcagcagcacattgagagcaagctcctgggctccaactcctcc
aggatgtacttcacccagactttactaccaggtcttgctggctcctctgtggaggtggtt
aaatccacaacgggtgtgaccccctcatctactggaagtggcgacaaggtctatgcccac
cagatggtccgcacagattcacgggaacagaagctcgatgcctttctgcagcccatgagc
aaggctctgtccagtcagcctcaggccattgtcccagaagacaggactgatgcttccagt
ggtggggctgggcagcaagatgaggaaatgcttgaactcccagagcctgctcaagtggct
gccacaaatcagggcacggaggtggatgtgacagaggggacctcggaaacgtcagagaag
agagggccctcttccagcccaggcaaccccagaaagaggcctcgggaaagctctgatgtg
gaaatggtggaagatgattcccgaaaggaaatgacagcagcgtgtacccctcggcggagg
atcatcaacctcaccagtgtgctgagcctccaggaagaaattaacgagcggggacatgag
acgctccgagagatgctgcataaccactcctttgtgggctgcgtgaatccgcagtgggcc
ttggcacagcatcagaccaagttataccttctcaacaccaccaaactgagtgaagaactg
ttctaccagatactcatttatgattttgccaattttggtgttctgagactctcggagcca
gcaccgctgtttgacctggccatgctcgccttggatagtcctgagagtggctggacggag
gaagatggtcccaaagaaggacttgctgagtacattgttgagtttctgaagaagaaggct
gagatgcttgcagactatttctctttggaaatcgatgaggaggggaacctgattggatta
cccctgctgatcgacaactatgtgccccctttggagggtctgcctatcttcattcttcga
ctagccacagaggtgaactgggatgaggagaaggaatgttttgaaagcctcagtaaagaa
tgtgctatattttactccattcggaagcagtatatatctgaggagtcaaccctctcaggc
cagcagagtgaagtgtctggctcctctgcaaagccctggaagtggactgtggaacacatc
gtctataaagccttccgctcacatcttctgcctcccaaacatttcacagaagatggaaat
atcctacagcttgctaacctgcccgatctgtacaaagtcttcgagcggtgttaa

DBGET integrated database retrieval system