KEGG   Ursus maritimus (polar bear): 103681472
Entry
103681472         CDS       T03271                                 

Gene name
MSH3
Definition
(RefSeq) mutS homolog 3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01524  Platinum drug resistance
umr03430  Mismatch repair
umr05200  Pathways in cancer
umr05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    103681472 (MSH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103681472 (MSH3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103681472 (MSH3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103681472 (MSH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:umr03400]
    103681472 (MSH3)
DNA repair and recombination proteins [BR:umr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     103681472 (MSH3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV
Other DBs
NCBI-GeneID: 103681472
NCBI-ProteinID: XP_008709258
UniProt: A0A384DR68
LinkDB
Position
Un
AA seq 1022 aa
MSGNSEPKKSLRTKSVLKSLEKLKEFCCDSALPQKRVQTEPPQKRFAVLPKCTDFDDINH
LRAKKAVSCEDSKSRISQKDKALSDLSPFGSSHTGNDNLQKTSDPKPSNKRTKSIYTPLE
LQYIELKQQQKDAILCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMTASIPTHRLFVH
VRRLVAKGYKVGVVKQTETAALKAVGDNRSSLFSRKLTALYTKSTLIGEDVNPLVKVDDA
VNVDEIITDSSTSFLLCICEIKENIKDKKKGNIFIGIVGVQPATGEVVFDSFQDSASRLE
LETRILCLQPVELLLPSHLSEQTEALIHRATAASVRDDRIRVERMDNVYFEYSHAFQAVT
EFYAKDAVDTQASQSFSGIINLEKPVICSLAAIIRYLKEFNLEKVLSQPKNFKQLSGEME
FMTINGTTLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKKWVTQPLLKLREINAR
LDAVSEVLHSESSVFSQIENHLRKLPDIERGLCSIYHKKCSTQEFFLIVKTLYHLKSEFQ
ALIPAVNSHVRSDLLQTFILEIPELLSPVEHYLRILNEQAAKTGDKTELFNDLTDFPLIK
KRKDEIQEVTDKIQIHLQEIRKILKNPSIQYVTVSGQEFMIEMKNSAVSCIPTDWVKVGS
TKAVSRFHSPFIVENYRHLNQLREQLVLDCSTEWLDFLENFSEHYHSLCKAVRHLATVDC
IFSLAKVAKQGHYCRPTLQEERKIVIKNGRHPVIDVLLGEQDQYVPNSTNLSGDSERVMI
ITGPNMGGKSSYIKQVALITVMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGQSTFM
EELTDTAEIIRQATSQSLVILDELGRGTSTHDGIAIAYATLEHFIRDVKSLTLFVTHYPP
VCELEKSYLQQVGNYHMGFLVNEDESKEDPGEEQVPDFVTFLYQITRGIAARSYGLNVAK
LADVPGEILTKAASKSKELEGLVNMKRKRLKCFAKLWMINDAKDLQKWRDEFEMEEIPGF
SS
NT seq 3069 nt   +upstreamnt  +downstreamnt
atgtctgggaactctgagccaaagaaatctctgaggaccaagagtgttttaaagtctctg
gaaaaattgaaagaattctgctgcgattctgcccttcctcaaaagagagtccagacagaa
cctcctcagaagagatttgcagttctaccaaaatgtactgattttgatgatatcaatcat
ctacgtgcaaagaaggcagtttcttgcgaagattccaaatctcgtattagtcaaaaggat
aaggcactttctgatctcagtccttttggatcatcacacacggggaatgacaatttacag
aaaacttctgatcctaaaccatctaacaaacggaccaaaagcatctatacacctttagaa
ttacaatacatagaactgaagcagcagcagaaagatgcaattttgtgtgtggaatgtgga
tataaatatagattctttggggaagatgcagagattgcagcccgggagctcaatatttat
tgccatttagatcacaactttatgacagcaagcatacctactcacagactgtttgttcac
gtacgccgcctcgtggcaaagggatataaggtgggagtcgtgaagcagacggaaactgca
gcattaaaggccgtcggggacaacagaagttccctgttttcccggaaattgactgctctt
tatacgaaatctacacttattggagaagatgtgaaccctttagtcaaggtggatgatgct
gtaaatgttgatgagataatcactgatagttctaccagctttcttctgtgtatctgtgaa
attaaggaaaatattaaggacaaaaaaaaggggaacattttcattggaatcgtgggagtg
cagcctgccacaggtgaggtcgtgtttgatagttttcaggactctgcctcccgtttggag
ctagaaactcggatactgtgcctgcagccggtggagctgctgcttccctcacacctgtca
gagcaaacagaggcgctcatccacagagccacagctgctagtgtgcgggatgacagaatt
cgagtagaacggatggataacgtgtattttgaatacagccatgctttccaggcagttaca
gagttttatgcaaaagatgcagttgacacccaagcttctcaaagtttttctggcatcatt
aacttggagaagcctgtgatttgctctttggctgccataataagatacctcaaagaattt
aacttggaaaaggtgctttcccagcccaagaattttaaacagttgtctggtgaaatggaa
tttatgacaattaatggaacaacattaaggaatcttgaaatcctacagaatcagactgac
atgaaaaccaaaggaagtttactttgggtcttagaccatactaaaacttcatttgggaga
cggaaattaaagaagtgggtgactcagccactccttaaactaagggagataaatgctcga
ctagatgctgtatctgaagtgctccattcagaatccagtgtgtttagtcagatagaaaat
catctgcgtaaactgcctgatatagagagaggactctgcagcatttatcacaaaaaatgc
tctacgcaagagttcttcttgattgtcaaaaccctgtatcacctgaagtcagaatttcaa
gcattgatacctgctgttaattcccacgttcggtcagacttgctccagacgtttatttta
gaaattcctgagctcctcagtccagtggagcattacttaaggatacttaatgaacaagct
gccaaaactggggataaaactgaattattcaacgaccttactgacttccctttaataaaa
aagaggaaggatgaaattcaagaagttactgacaagatccaaatacatttgcaagaaata
cgaaaaatactaaaaaacccttctatacaatatgtgacagtgtcaggacaggagtttatg
attgaaatgaagaattctgctgtatcttgtataccaactgattgggttaaggttggaagc
acaaaagctgtgagccgttttcactctccttttattgtagaaaattacagacatctgaat
cagctccgggagcagctagtccttgactgcagtactgaatggcttgattttctagagaat
ttcagtgaacattatcactccttgtgtaaagcagtacgtcacctagcaactgttgactgc
attttctccctggccaaggtcgctaagcaaggacattactgcagaccaactctacaagaa
gaaaggaaaattgtgattaaaaatggccggcaccctgtgattgacgtgttgctgggagaa
caggatcagtatgttcccaacagtacgaatttatcaggagattcagagagagtaatgata
atcactggaccaaacatgggtggaaagagctcctacataaaacaagttgcactgattact
gtcatggctcagattggctcctacgttcctgcagaagaagcaacaattggaatcgtggat
ggcattttcacgaggatgggtgctgcagataatatatataaaggacagagtacctttatg
gaagagctgactgacacagcagaaataataagacaagcaacatcccagtccttggttatc
ttggatgaattgggaagagggacgagtactcatgatggaatcgccattgcttatgctaca
ctcgagcattttattagagatgtgaaatccttaaccctgtttgtcacccattatccacca
gtttgtgaattagaaaaaagttacttacaacaggtgggaaattatcacatgggattcttg
gtgaatgaggatgaaagcaaagaggatccaggtgaagaacaagtccctgattttgtcact
tttctttatcaaataaccagaggaattgcagcaaggagttatggactaaatgtggctaaa
ctagcagatgttcctggagaaattttaacgaaagcagctagcaagtcaaaagagttagaa
ggattagtaaatatgaagaggaaaaggctaaagtgttttgcaaagttatggatgataaat
gatgcaaaagacctacagaaatggagagacgagtttgaaatggaagaaattccaggcttc
tcttcttga

DBGET integrated database retrieval system