KEGG   Ursus maritimus (polar bear): 103681799Help
Entry
103681799         CDS       T03271                                 

Gene name
DOT1L
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00310  Lysine degradation
umr05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103681799 (DOT1L)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    103681799 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103681799 (DOT1L)
Enzymes [BR:umr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103681799 (DOT1L)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103681799 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 103681799
NCBI-ProteinID: XP_008709604
LinkDB All DBs
Position
Un
AA seq 1356 aa AA seqDB search
MGNTVQRETLIPGWPQPSAWTSALLCAVQPTFLMLSLEASLSHSDEVQLAYVIILGKGPP
LHPAHFSPKRWVLPCLLAVLRVPPLPRERHLGQDKHHDAAHEIIETIRWVCEEIPDLKLA
MENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHILQQV
YNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVA
AATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIAN
TRPGVLQSAGDRWKLGDLRVVAHPRAIFLGRSGRIVSSKPFAPLNFRINSRNLSDIGTIM
RVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKS
TTTTPTKVPESKAAVPADTPMDSGAEEEKAGATAIKKPSPSKARKKKLNKKGRKMAGRKR
GRPKKMSTANPERKPKKSQTALDLLHAQAAAQTAAPSPQDAYKSPHSPFYQLPPSVQRHP
PDQLRLAPTPPALQKLLESFKIQYLQFLAYTKTAQYKASLQQLLDQEKEKNARLLGAAQQ
LFGHCQAQKEEIKRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQTEQLQKDNRE
LRSQSLQLLKARCEELKLDWSTLSLENLLKEKQALRTQISEKQRHCLELQISIVELEKSQ
RQQELLQLKSCVPPDDALSAHLRGKGALGRELEADAGRLHLDLDCSKFSLPHFSSTSPEL
SINGHAATYEVCSVLSRPSSKQNTPQYLASPLDQEVIPCTPSHSSRSRLEKMSGLALPDY
TRLSPAKLVLRRHLSQDHAASGKTAECTRAEHAKENGLPYQSPGIANGIKLSPQDPRPSS
PVALQMTGERGGEKGLKERAYASSGEAITSLPVSIPLSTVQPSKLPVSIPLASVVLPSRA
EKVRSTPSPVPQTRESSSALEKQMGTNAHSAGSKSLAPAPAGQSALLAPRSMPLPTGARG
DSQPLPLLLLEREGARIGQGREDPRSARPGSEPAHLLPATGSELHYSAWAVCPTRLAMPL
WSSLAGFSDPEGEAKRRIVFTISAGSSSAKQSPPSKPSPLPTGARGDSSQGHGPDSRKRG
RRKRAAAGTPSLSSGVSPKRRALPSVAGLFTQSSGSPLNLNSMVSNINQPLEITAISSPE
SLKSSPVPYQDNDQPPVLKKEKPLSQTNGAHYSPLTSDEEQGSEDEPGSARIERKIATIS
LESKSPPKTLESGEYTPPPPQPHRPFLGTFAPGPQFALGPMSLQANLGSSVLQSLFSSVP
AAAGLVHVSSAATRLTNSHAMGSFSSGVAGGAVGGN
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacacggtgcagagagagacgctcatccccgggtggccgcagccctcagcttgg
acaagcgcccttctctgcgcagtgcagcccactttcttgatgctgtccttggaagcatcg
ttgtctcattctgatgaagtgcagcttgcttacgtgattattctgggaaagggccctccc
ctccaccctgcacacttctcaccgaagcggtgggtgctgccgtgtctcctggccgtgctc
cgggtgccaccgctgcctcgtgagaggcacttggggcaggacaaacaccacgatgctgct
catgaaatcatcgagaccatccgatgggtctgtgaagagatcccggacctcaagcttgcg
atggagaattacgttctcatcgactacgacaccaaaagctttgaaagcatgcagaggctc
tgtgacaaatacaaccgcgccatcgacagcatccaccagctgtggaagggaaccacgcag
cccatgaaactgaacacgcggccgtccaacgggctcctgcggcacatcctgcagcaggtc
tacaaccactcggtgacggaccccgagaagctcaacaactacgagcccttctccccggag
gtgtacggggagacctcctttgacttggtcgcgcagatgatcgatgagatcaagatgacc
gaggacgacctgtttgtggacctgggcagtggagtgggccaggtcgtgctgcaggtcgcc
gcagccaccaactgcaagcatcactatggcgtggagaaagccgacatcccagccaagtac
gcggagaccatggaccgagagttcaggaagtggatgaaatggtatggaaaaaagcatgca
gaatacacactggaaagaggcgacttcctctcggaagagtggagagagcggattgccaac
acaaggccgggggtgctgcagtccgctggagaccgctggaagctcggggacctgagagtt
gttgcacaccccagagccatcttcctggggagaagtggcagaatcgtttcctcgaagccc
tttgcgcctctgaacttcagaataaacagcagaaacttgagtgacatcggcaccatcatg
cgcgttgtggagctctcgcccctgaaaggctcggtgtcctggacggggaagccggtctcc
tactacctgcacaccatcgaccgcaccatacttgaaaactatttttctagtctgaaaaac
ccaaaactcagggaggaacaggaggcagctcggcgcaggcagcagcgagagaacaagagc
accacgaccactcccaccaaggtgcccgaaagcaaggctgccgtgcccgcggacaccccg
atggattccggggccgaggaagaaaaggctggggcgactgccatcaaaaagccgtccccc
tccaaagcccggaagaagaagctgaacaagaaggggcggaagatggccggccggaagcgc
gggcgtcccaagaagatgagcactgcgaaccccgagcgtaagcccaagaagagccaaact
gcactggacctcctgcacgcccaggccgcggcgcagacggcagcgccctcgccgcaggat
gcgtacaagtcacctcatagcccgttttaccagctacctcccagtgtgcagcggcacccc
cccgaccagctgcgtctggcacccaccccgcccgcactgcagaagctgctagaatccttc
aagattcagtacttgcagttcttggcgtataccaagaccgcccagtacaaggccagcctg
cagcagctgctggaccaggagaaggagaagaacgcgcggttgctaggcgctgcccagcag
ctgttcggccactgtcaggcccagaaagaggagatcaagaggcttttccagcagaaactg
gatgagctgggagtgaaggcgctgacctacaatgacctgatccaggcgcagaaggagatc
tcggctcacaaccagcagctgagggaacagacggagcagctgcagaaggacaacagggag
ctgaggagccagagcctgcagctgctcaaggctaggtgtgaggagctgaagctggactgg
tccacgctgtccctggagaacctgctgaaggagaagcaggccctgcggacccagatctcc
gagaagcagaggcactgcctggagctgcagataagcatcgtggagctggagaagagccag
cggcagcaggagctcctgcagctcaagtcctgcgtgccgccggacgatgccctgtcggca
cacctgcgcgggaaaggcgccctgggccgggagctggaggccgacgccggccggctgcac
ctcgacctggactgctccaagttctctctgccccacttcagcagcacgagcccagaactc
tccataaacggccacgcagccacctatgaggtctgcagtgtgctgagccggccctcgtcc
aagcagaacaccccccagtacctggcctcccccctggaccaggaagtcataccctgcacg
cccagccacagcagccgctcgaggctcgagaagatgtcgggcctggccttgcccgactac
acccggctctccccagccaagctagtgctgaggcgtcacctgagccaggaccatgcggcc
agtggcaagactgcggaatgcacccgcgctgagcatgccaaggagaacggccttccgtac
cagagccctggcatcgcaaatggcatcaagctgagccctcaggaccctcgaccttcatcc
cccgtggccttacagatgacaggggagaggggcggcgagaagggtttgaaggagcgtgcc
tacgccagcagcggggaggccatcaccagcctgcccgtcagcatcccgctcagcaccgtg
cagccaagcaagctgcctgtcagcatccctctggccagtgtggtgctgcccagccgcgcc
gagaaagtgagaagcacccccagccccgtaccgcagacccgagagtcctcgtccgcactt
gaaaagcagatgggcacgaacgcccacagtgctggaagcaaaagcctcgccccagctcct
gcaggtcagagtgcccttcttgctcctaggtccatgcccttgcccacgggtgcccgcggg
gacagccagcctctgccgctgctgctgctggaaagagaaggagccaggataggccaggga
cgtgaggaccccaggtctgccaggccaggctctgagccggcccacctcctcccggccacg
gggtctgagctccattattcagcctgggcagtgtgccccacccggctggcgatgcccttg
tggagctccctggccggcttctcagaccccgagggcgaagccaagaggaggatcgtcttt
accatctcagctggcagcagcagtgccaagcagtcacctcccagcaaacccagccctctg
cccacgggtgcccgcggggacagcagccagggccacgggccggacagtcgcaagcggggc
aggaggaagcgggcagcagccgggacccccagcctgagttctggcgtgtcgcccaagcgt
cgcgccctgccgtccgttgccggcctcttcacgcagtcgtcagggtccccactgaacctc
aactcgatggtcagcaacattaatcagcctttggaaatcacggccatctcgtcccccgag
agcctgaagagctcccctgtcccctaccaggacaacgaccagccgcccgttctcaagaag
gagaagcccttgagccagaccaacggggcccactactccccattgacctcagacgaggag
caaggctccgaggacgagccgggcagcgccagaatcgagagaaaaattgcaacaatttcc
ttagaaagcaaatctcctccgaaaaccttggaaagtggtgagtacacgcccccccctccc
cagcctcaccgccccttcctgggcacttttgcccccggcccgcagtttgccctgggtccc
atgtccctgcaggccaatctgggctcgtccgtgctacagtccttgttcagctctgtgcca
gccgctgccggcctggtgcacgtctcgtccgccgcgaccagactgaccaactcgcacgcc
atgggcagcttctcctccggggtggcaggcggcgctgttggaggtaactag

DBGET integrated database retrieval system