KEGG   Ursus maritimus (polar bear): 103681805Help
Entry
103681805         CDS       T03271                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
umr  Ursus maritimus (polar bear)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:umr01002]
    103681805 (TMPRSS9)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103681805 (TMPRSS9)
Peptidases [BR:umr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103681805 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SEA Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 103681805
NCBI-ProteinID: XP_008709610
UniProt: A0A384DS44
LinkDB All DBs
Position
Un
AA seq 825 aa AA seqDB search
MEPTTGDLQPVPGAAKEVPALDATCCRVALSTVVATSIVMVTLGVLMASLSTQGVDVEHT
AELQGVQYARSLQQETSEYYGMLTPTLERLFVSSFQKTELEASCVGCTVLSYRAGNSSVF
VHFRLHFLLRALQSLSLGLEEELLQQGLRARLQGHGVPLAAHGTIVSAELTGNQKGPLTE
RDLKSGHCPGNTFSCRNSQCVTKVNPECDDRVDCSDGSDEAHCDCGLQPGWKTAGRIVGG
VEASPGEFPWQVSLRENNEHFCGAAVIGARWLVSAAHCFNEFQDPRAWVAYAGTTFLSGT
EASTVRARVALVKPETLQKATVQLLDQGRGASLYGHSLTDRMLCAGYLDGKVDSCQGDSG
GPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDWILEAITVASKPLAPTAAP
TSAIPSIAQPASPESPVVHTRARPTRGPSTAPPDSVTASRPQECGARPAVEKPTRIVGGL
GAASGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAHLGTVSLTGIGG
TPVKMGLRRAVLHPQYNPGTLDFDVAVLELARPLGFNTFIQPVCLPLAIQKFPVGRKCMI
SGWGSTREGNATKPDILQRASVGIIDQKACSALYNFSLTDRMLCAGFLEGKVDSCQGDSG
GPLACEEAPGVFYLAGIVSXGCAQAGRPGVYTRITRLKGWILDTMSSGPLPSPPPPLPGP
PPSTRPSSRTAAGPTVPAVLASRATFRATSQPASRTAATASATVGGQTPLPSAPSPTVGF
QPPGPARAVVGNRTGNQRHSKMASGTEESKPTPQAPARGLGEHLG
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggaacccaccaccggtgacttacagcctgtgcctggggcagcaaaggaagtcccagct
ctggatgccacgtgctgccgtgtggccctctccacggtggtggccaccagcattgtcatg
gtcaccctgggagtcctcatggcctccctctctacacagggtgtcgacgtggagcacacg
gctgagctgcagggggtccagtatgcccgcagcttgcagcaagagacctcagagtactac
ggcatgctgacgcccactctggaaaggctgttcgtaagcagctttcagaagacagagttg
gaggccagctgtgtgggctgcactgtgctaagttacagggctgggaattccagtgtcttt
gtgcatttccggctacacttcctgctgcgagccctgcagtcactgagtctgggcctggag
gaggagctgttgcagcagggactccgagcaaggctgcaggggcacggcgtccccctggct
gcccatggcaccattgtgtccgccgagctcacaggtaaccagaaagggccactgacagaa
agagacttaaaatcaggtcactgtccagggaacaccttttcctgccggaacagccagtgt
gtgaccaaagtgaacccggagtgtgatgacagagtggactgctccgatggatctgatgag
gctcactgtgactgcggtctacagcctggctggaagacggcgggccggatcgtgggcggc
gtggaagcgtcccccggggagttcccgtggcaagtcagccttcgagaaaacaacgaacac
ttctgtggggctgctgtcattggggcccggtggctggtgtctgcggcccactgcttcaac
gagttccaagacccaagagcgtgggtggcatacgcgggcacgacgttcctgagcggcacg
gaggccagcacggtgcgggcgcgcgtggccctggtgaagccagagacgctgcagaaagcc
accgtgcagctgctggaccagggccggggtgccagcctgtacggccactcgctcaccgac
aggatgctgtgtgccggctacctggacgggaaggtggactcctgccagggcgactcagga
ggccccctggtctgtgaggagccctccggcaggttcttcctggccggcatcgttagctgg
gggattggctgtgcagaagcccggcgtcccggtgtctatgcccgcgtgaccaggcttcgg
gactggatcctagaggccatcactgtggcgagcaagcctctggcccccaccgcagctccc
acctccgccatccccagcattgcccagcccgccagtcctgagagcccagtggtccacacc
cgtgccagacccacgcggggtcccagcacggcgcctcctgactcagtgaccgcctctagg
ccacaagagtgcggggccaggccggccgtggagaagcccacgcggatcgtgggtggtctg
ggagccgcctcgggggaggtgccctggcaggtcagcctgaaggaaggttcccggcacttc
tgcggcgcgaccgtggtgggcgaccgctggctgctgtcggctgcccactgcttcaaccac
acgaaggtggagctggtccgggcccacctgggcaccgtgtccctcacgggcatcggcgga
accccggtgaagatgggtctcaggagggcagtgctgcacccccagtacaatcccggcacc
ctggacttcgacgtggccgtcctggagctggccaggcccctgggtttcaacacgttcatc
cagcctgtgtgcctgcccctggccatccagaagttccccgtcggccgcaagtgcatgatc
tccggatggggcagcacgcgggagggcaacgccaccaagcctgacattctgcagagagcg
tccgtgggcatcatagaccagaaggcctgcagcgccctctacaacttctcgctcacggac
cggatgctctgcgcgggcttcctggagggcaaggtcgactcctgccagggcgactctggc
ggacccctggcctgcgaggaggcgcccggcgtgttttatctggcggggatcgtgagtnnc
ggctgtgcccaggccgggaggcccggcgtgtacacacgcatcaccaggctgaagggctgg
atcctggacaccatgtcttccgggcccctgcccagccctcccccacccctcccgggaccc
ccgccctccaccaggccttcctccaggacggcagctggccccaccgtcccagcggtcctg
gccagcagagctaccttccgggccaccagccaacctgccagcaggactgccgccaccgcg
agcgccactgtggggggacagaccccacttcccagtgcccccagccccaccgtgggcttc
cagccaccaggcccggcccgagctgtggtggggaaccggacggggaaccagaggcacagt
aagatggcgagcgggactgaggagagcaagccgaccccacaggctcctgcacggggcctc
ggggagcatcttggctag

DBGET integrated database retrieval system