KEGG   Ursus maritimus (polar bear): 103681847
Entry
103681847         CDS       T03271                                 

Gene name
TICAM1
Definition
(RefSeq) toll like receptor adaptor molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04064  NF-kappa B signaling pathway
umr04217  Necroptosis
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr05133  Pertussis
umr05135  Yersinia infection
umr05142  Chagas disease
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05168  Herpes simplex virus 1 infection
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103681847 (TICAM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103681847 (TICAM1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103681847 (TICAM1)
   04621 NOD-like receptor signaling pathway
    103681847 (TICAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103681847 (TICAM1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103681847 (TICAM1)
   05133 Pertussis
    103681847 (TICAM1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103681847 (TICAM1)
   05160 Hepatitis C
    103681847 (TICAM1)
   05164 Influenza A
    103681847 (TICAM1)
   05168 Herpes simplex virus 1 infection
    103681847 (TICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103681847 (TICAM1)
   05165 Human papillomavirus infection
    103681847 (TICAM1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103681847 (TICAM1)
SSDB
Motif
Pfam: TRIF-NTD TIR_2
Other DBs
NCBI-GeneID: 103681847
NCBI-ProteinID: XP_008709651
UniProt: A0A384DRG2
LinkDB
Position
Un
AA seq 614 aa
MACADLSLSSAFDILGAAGEGKLLHLKHKLKTLRPGCRGADLLHAMVLLKLGQETEARIS
LEALKADAVARLVARQWAGMDSAEVPEEPPDLSWAVARVYHLLAEEKLCPATMRDMAYQA
ALHTFSSRDDHRLAELQGEAQDRCGWGIIGDPESFQPLHSDLGCLPPSSVSPSGTRSLPQ
PIEHLSGWSRGRSLRSTGSPASLASNLEISQSPTMPFLRTSPRPPPQGETVSPPSAETAN
PPQGETVSPPSAETANPPQGETVSPSSGETASPPSGETASPPLEETASPSPGETTSSRMP
PNSAAPRLTELVPDASSAGQPDPPRALEISTHYPVECTDALAAPKSLSLPSRNTWPDKGQ
SPLPLPVEDTASQVASASPPPPSPPRTAPPRPSPATLPSTGLASSSLCPPSPELESEQKF
YNFVILHVAADEHIALRVRERLEALGVPDGATFCEDFQVPGRGELHCLQDAIDHSAFTIL
LLTPNFDCRLGLHQASQSLMNSLTRPGRQDCVIPFLPLESSQAPLSPHTTSLLTGLVWLD
ERSQIFARRVANTFKAQRLRARKANWKKEQDVRALQEQRRHLEGERQQVASIVTWPSAAR
DFGKCSLLLSNALC
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggcctgcgcggacctgtcgctctccagcgcctttgacattctaggtgccgcaggggag
ggcaagctcttgcaccttaagcacaagctgaagaccctgcgcccgggctgccggggggcg
gacctcctgcacgccatggtgctcctgaagctgggccaggagaccgaggccaggatctcc
ctggaagcactgaaggcggacgctgtggcccggctcgtggcgcgccagtgggccggcatg
gacagcgccgaggtcccagaggagcccccagacttgtcctgggcagttgcccgggtatac
cacctgctcgccgaggagaagctgtgcccagccactatgcgggacatggcctaccaggcc
gccctccatacgttcagctccagggatgaccaccggctcgccgagctccagggagaggcc
caggaccggtgtgggtggggcatcatcggggacccagagagcttccagccccttcactct
gatctgggctgcctgccaccatcctcagtgtcaccctcaggcacccgcagccttccacag
cccatagagcacctttcaggctggagcagagggcgttccctgagatccactggcagcccc
gcctccctggccagcaatctggaaatcagccagtcgcccaccatgccctttctcaggacg
agccccaggccacccccacaaggggagactgtcagccccccatcggcagagactgccaac
cccccacaaggggagactgtcagccccccatcggcagagactgccaaccccccacaaggg
gagactgtcagcccctcatcaggagagacagccagccccccatcgggggagactgccagc
cccccactggaggagactgctagcccctcgcctggggagactaccagctcccggatgcca
ccaaacagcgcagcccctaggcttactgagctggtcccagatgcaagctctgctggccag
cctgacccccccagagctctggaaatcagcacccactacccggtggagtgcaccgatgcg
ttggcagcccccaaatctctctccttgccctccagaaacacttggcctgacaagggccag
agcccactcccacttcctgtagaagataccgcttcccaggtggccagcgccagcccacct
ccaccctcacccccgaggacagcccctccccgcccttctccagccacccttccttccact
ggcctggcctcctccagcctgtgccccccttctcctgagctggagtccgagcagaaattc
tataactttgtgatcctgcacgttgccgcggacgaacacattgccctgagggtccgggag
aggctcgaggccctgggggtccctgatggggccaccttctgtgaagatttccaggtgccc
gggcggggcgagctgcactgcctgcaagacgccatcgaccactcggccttcaccatcctg
ctgctcacccccaacttcgactgccgcctgggcctgcatcaggccagccagtcgctgatg
aacagcctcacgcggcctgggcggcaagactgcgtgatccccttcctgcccctggagagc
tcccaggccccgctcagtccccacacgaccagcctgctcaccggcctggtgtggctggac
gagcgctcccagatcttcgccaggagggtggccaacaccttcaaggcgcagaggctacga
gcccgcaaggccaactggaagaaggaacaggacgtccgggccctgcaagagcagcgccgg
cacctggagggcgagcggcagcaggtggcaagcatcgtcacctggccctcggctgcacgg
gactttgggaaatgtagtcttctgctgagcaatgcgctttgctaa

DBGET integrated database retrieval system