KEGG   Ursus maritimus (polar bear): 103682282
Entry
103682282         CDS       T03271                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04022  cGMP-PKG signaling pathway
umr04141  Protein processing in endoplasmic reticulum
umr04151  PI3K-Akt signaling pathway
umr04211  Longevity regulating pathway
umr04261  Adrenergic signaling in cardiomyocytes
umr04668  TNF signaling pathway
umr04728  Dopaminergic synapse
umr04911  Insulin secretion
umr04915  Estrogen signaling pathway
umr04918  Thyroid hormone synthesis
umr04925  Aldosterone synthesis and secretion
umr04926  Relaxin signaling pathway
umr04927  Cortisol synthesis and secretion
umr04928  Parathyroid hormone synthesis, secretion and action
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr05020  Prion disease
umr05030  Cocaine addiction
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103682282 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103682282 (ATF6B)
   04022 cGMP-PKG signaling pathway
    103682282 (ATF6B)
   04151 PI3K-Akt signaling pathway
    103682282 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103682282 (ATF6B)
   04915 Estrogen signaling pathway
    103682282 (ATF6B)
   04926 Relaxin signaling pathway
    103682282 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    103682282 (ATF6B)
   04918 Thyroid hormone synthesis
    103682282 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    103682282 (ATF6B)
   04925 Aldosterone synthesis and secretion
    103682282 (ATF6B)
   04927 Cortisol synthesis and secretion
    103682282 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103682282 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    103682282 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    103682282 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103682282 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    103682282 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    103682282 (ATF6B)
   05031 Amphetamine addiction
    103682282 (ATF6B)
   05034 Alcoholism
    103682282 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103682282 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103682282 (ATF6B)
   05161 Hepatitis B
    103682282 (ATF6B)
   05163 Human cytomegalovirus infection
    103682282 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103682282 (ATF6B)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103682282 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407
Other DBs
NCBI-GeneID: 103682282
NCBI-ProteinID: XP_008710086
UniProt: A0A384DSQ7
LinkDB
Position
Un
AA seq 701 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDDVAEEQTQLFRCPEQDVPFGS
SSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSSQASGVGE
VLVVKTESLAPPLCLLGDDPTSPFETVQINVGPTSDDASDVQTKVEPVSPSSSINSEASL
LSAESPNQAFIGEEVLEVKTESPSPQGCLLQDVLGPPLGGVQISMGPSSDGSLGKALPTR
KPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQPEGPAPPAP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQXA
DNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPPA
PISPRMSGEQPQPRRHLLEFSTQEPIQGVEPLQGSSLGPEEPQPSTPGRPSFRNLTAFPG
GAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQL
RKKSPPVKAVPTQPLGPPERDPVGQLQLYRRPDRSQPEFLDAIDRREDTFYVVSFRRDHL
LLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTSTV
PPSLRKQPSSTPGNATGGPLPASAAGQAHQASHQPLYLNHP
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggcggaactgatgctcctcagcgagattgcggacccaacacgttttttcacggacaac
ttgctgagcccggaggactggggtctgcggaacagcaccttgtacactggcctggatgat
gtggcggaggagcagacgcagctcttccgctgcccagagcaggatgtcccgtttggcagc
agctccctggatgtggggatggatgtcagcccccctgagccaccttgggaccccctgcct
atcttcccagatcttcaggtgaagtctgagccatcctccccctgctcctcttcctccctc
agctctgaatcatcccatctttccacagagccctccagccaggcttctggtgtaggagag
gtgctggttgtgaagacagagtccttggcacccccactctgcctcctaggagatgaccca
acatccccatttgaaactgtccagatcaatgtgggtcccacctctgatgacgcctcagat
gtccagaccaaggtagaacctgtctctccatcttcctccatcaactctgaggcttccctg
ctctcagcggagtcccccaaccaggcttttataggagaggaggtactggaagtgaagaca
gagtcaccgtcccctcaagggtgtctactgcaggatgtcctaggccccccacttggaggt
gtccagatcagcatgggcccatcctctgatggctccttaggcaaagcccttcccacccgg
aaaccacccctgcagcccaaacctgtggtgataaccaccgtcccaatgccacccagagct
gtgcctcccagcaccaccatccttttgcagccccttgtccagccacccccagtctcccca
gttgtcctcatccaaggtgctattcgggtccagcctgaggggccggcccccccggctcca
aggcctgagaggaagagcattgttccagcccctatgcctgggaactcctgcccacctgaa
gtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcggcctgc
cagtcacggaggaagaagaaggagtacctgcaggggctggaggctcggctgcagnnggcc
gacaaccagcagctccgccgggagaacgctgccctccggcggcggctggaggccctgctg
gctgagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatcatggtc
ttccttctcttcatcgccttcaactttggacctgtcagcatcagtgagcctcctccggct
cccatctctcctcggatgagtggagagcagcctcagccccggagacatttgctggagttc
tcaacgcaagagccaattcagggagttgaacccctccagggttcctccctgggccctgag
gagccccagcccagcactccaggccggccaagtttcaggaacctgacagccttccccggg
ggtgccaaggagttgctgctgagagacctggaccagctcttcctctcctctgactgccgg
cacttcaaccgcaccgagtctctgaggcttgctgatgagctgagtggctgggtccagcgc
caccagagaggccggcggaagattcctcagagagcccaggagagacagaagtctcagcta
cggaagaagtcgcctccagttaaggcagtccccacccaacccctggggcccccagagagg
gatcctgtgggccagctgcagctgtatcgccgcccagaccgttcgcagccagaattcctg
gatgcaatcgaccgacgagaagacacgttttatgttgtgtccttccgaagggaccacttg
ctgctccctgccatcagccacaacaagacctctcggcccaagatgtccctggtgatgcct
gccatggctcccaatgagaccctgtcaggccggggggccccgggggactatgaggagatg
atgcagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccacggtg
cccccctcactccgaaaacagccatcctcgaccccgggcaatgccacaggtggccccttg
ccagcttctgcagccggccaggcccaccaggcctcccaccagcccctctacctcaatcac
ccctga

DBGET integrated database retrieval system