KEGG   Ursus maritimus (polar bear): 103682322
Entry
103682322         CDS       T03271                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01523  Antifolate resistance
umr04010  MAPK signaling pathway
umr04060  Cytokine-cytokine receptor interaction
umr04061  Viral protein interaction with cytokine and cytokine receptor
umr04064  NF-kappa B signaling pathway
umr04071  Sphingolipid signaling pathway
umr04150  mTOR signaling pathway
umr04210  Apoptosis
umr04217  Necroptosis
umr04350  TGF-beta signaling pathway
umr04380  Osteoclast differentiation
umr04612  Antigen processing and presentation
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04622  RIG-I-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04640  Hematopoietic cell lineage
umr04650  Natural killer cell mediated cytotoxicity
umr04657  IL-17 signaling pathway
umr04660  T cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04668  TNF signaling pathway
umr04920  Adipocytokine signaling pathway
umr04930  Type II diabetes mellitus
umr04931  Insulin resistance
umr04932  Non-alcoholic fatty liver disease
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04940  Type I diabetes mellitus
umr05010  Alzheimer disease
umr05014  Amyotrophic lateral sclerosis
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05132  Salmonella infection
umr05133  Pertussis
umr05134  Legionellosis
umr05135  Yersinia infection
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05143  African trypanosomiasis
umr05144  Malaria
umr05145  Toxoplasmosis
umr05146  Amoebiasis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05168  Herpes simplex virus 1 infection
umr05169  Epstein-Barr virus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05205  Proteoglycans in cancer
umr05310  Asthma
umr05321  Inflammatory bowel disease
umr05322  Systemic lupus erythematosus
umr05323  Rheumatoid arthritis
umr05330  Allograft rejection
umr05332  Graft-versus-host disease
umr05410  Hypertrophic cardiomyopathy
umr05414  Dilated cardiomyopathy
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103682322 (TNF)
   04350 TGF-beta signaling pathway
    103682322 (TNF)
   04064 NF-kappa B signaling pathway
    103682322 (TNF)
   04668 TNF signaling pathway
    103682322 (TNF)
   04071 Sphingolipid signaling pathway
    103682322 (TNF)
   04150 mTOR signaling pathway
    103682322 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103682322 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103682322 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103682322 (TNF)
   04217 Necroptosis
    103682322 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103682322 (TNF)
   04620 Toll-like receptor signaling pathway
    103682322 (TNF)
   04621 NOD-like receptor signaling pathway
    103682322 (TNF)
   04622 RIG-I-like receptor signaling pathway
    103682322 (TNF)
   04625 C-type lectin receptor signaling pathway
    103682322 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    103682322 (TNF)
   04612 Antigen processing and presentation
    103682322 (TNF)
   04660 T cell receptor signaling pathway
    103682322 (TNF)
   04657 IL-17 signaling pathway
    103682322 (TNF)
   04664 Fc epsilon RI signaling pathway
    103682322 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103682322 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103682322 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103682322 (TNF)
  09163 Immune disease
   05310 Asthma
    103682322 (TNF)
   05322 Systemic lupus erythematosus
    103682322 (TNF)
   05323 Rheumatoid arthritis
    103682322 (TNF)
   05321 Inflammatory bowel disease
    103682322 (TNF)
   05330 Allograft rejection
    103682322 (TNF)
   05332 Graft-versus-host disease
    103682322 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103682322 (TNF)
   05014 Amyotrophic lateral sclerosis
    103682322 (TNF)
   05020 Prion disease
    103682322 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    103682322 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103682322 (TNF)
   05410 Hypertrophic cardiomyopathy
    103682322 (TNF)
   05414 Dilated cardiomyopathy
    103682322 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103682322 (TNF)
   04940 Type I diabetes mellitus
    103682322 (TNF)
   04932 Non-alcoholic fatty liver disease
    103682322 (TNF)
   04931 Insulin resistance
    103682322 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103682322 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103682322 (TNF)
   05135 Yersinia infection
    103682322 (TNF)
   05133 Pertussis
    103682322 (TNF)
   05134 Legionellosis
    103682322 (TNF)
   05152 Tuberculosis
    103682322 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103682322 (TNF)
   05170 Human immunodeficiency virus 1 infection
    103682322 (TNF)
   05161 Hepatitis B
    103682322 (TNF)
   05160 Hepatitis C
    103682322 (TNF)
   05171 Coronavirus disease - COVID-19
    103682322 (TNF)
   05164 Influenza A
    103682322 (TNF)
   05168 Herpes simplex virus 1 infection
    103682322 (TNF)
   05163 Human cytomegalovirus infection
    103682322 (TNF)
   05169 Epstein-Barr virus infection
    103682322 (TNF)
   05165 Human papillomavirus infection
    103682322 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103682322 (TNF)
   05144 Malaria
    103682322 (TNF)
   05145 Toxoplasmosis
    103682322 (TNF)
   05140 Leishmaniasis
    103682322 (TNF)
   05142 Chagas disease
    103682322 (TNF)
   05143 African trypanosomiasis
    103682322 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103682322 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:umr04052]
    103682322 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:umr00536]
    103682322 (TNF)
Cytokines and growth factors [BR:umr04052]
 Cytokines
  Tumor necrosis fators
   103682322 (TNF)
Glycosaminoglycan binding proteins [BR:umr00536]
 Heparan sulfate / Heparin
  Cytokines
   103682322 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 103682322
NCBI-ProteinID: XP_008710131
UniProt: A0A384DSV1
LinkDB
Position
Un
AA seq 233 aa
MSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR
EELPDGLQLINPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELT
DNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRE
TPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcactccccaagaag
gcagggggcccccagggctccagaaggtgcttgtgcctcagcctcttctccttcctcctc
gtcgcaggagccaccacgctcttctgcctgctgcacttcggcgtgatcggcccccagagg
gaagagctcccagatggactccaactaatcaaccctctggcccagacagtcaaatcatct
tctcgaactccaagtgacaagcctgtagctcatgttgtagcaaaccccgaagctgagggg
caactccagtggctgagccggcgtgccaatgccctcctggccaatggtgtggagctgaca
gacaaccagctaatagtgccatcagacgggctgtacctcatctactcccaggtcctcttc
aagggccaaggatgcccttccacccatgtgctcctcacccacaccatcagccgcttcgct
gtctcttaccagaccaaggtcaacctcctctctgccatcaagagcccttgccaaagggag
accccagaggggactgaggccaagccctggtacgagcccatctacctgggaggggtcttc
caactggagaagggtgatcgactcagcgctgagatcaacctgcctgactacctcgacttt
gccgagtctgggcaggtctactttggaatcattgccctgtga

DBGET integrated database retrieval system