KEGG   Ursus maritimus (polar bear): 103682503
Entry
103682503         CDS       T03271                                 

Gene name
CDK2
Definition
(RefSeq) cyclin dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04068  FoxO signaling pathway
umr04110  Cell cycle
umr04114  Oocyte meiosis
umr04115  p53 signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04218  Cellular senescence
umr04914  Progesterone-mediated oocyte maturation
umr04934  Cushing syndrome
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05162  Measles
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05169  Epstein-Barr virus infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05215  Prostate cancer
umr05222  Small cell lung cancer
umr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103682503 (CDK2)
   04151 PI3K-Akt signaling pathway
    103682503 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103682503 (CDK2)
   04114 Oocyte meiosis
    103682503 (CDK2)
   04115 p53 signaling pathway
    103682503 (CDK2)
   04218 Cellular senescence
    103682503 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103682503 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103682503 (CDK2)
   05203 Viral carcinogenesis
    103682503 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    103682503 (CDK2)
   05215 Prostate cancer
    103682503 (CDK2)
   05222 Small cell lung cancer
    103682503 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103682503 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103682503 (CDK2)
   05161 Hepatitis B
    103682503 (CDK2)
   05160 Hepatitis C
    103682503 (CDK2)
   05162 Measles
    103682503 (CDK2)
   05169 Epstein-Barr virus infection
    103682503 (CDK2)
   05165 Human papillomavirus infection
    103682503 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103682503 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:umr03032]
    103682503 (CDK2)
   03036 Chromosome and associated proteins [BR:umr03036]
    103682503 (CDK2)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103682503 (CDK2)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103682503 (CDK2)
DNA replication proteins [BR:umr03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    103682503 (CDK2)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103682503 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 103682503
NCBI-ProteinID: XP_008710326
UniProt: A0A384DTF0
LinkDB
Position
Un
AA seq 346 aa
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHHARCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVS
TPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaaggtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acggagggtgtacccagtactgctatacgagagatctctctgcttaaggagcttaaccac
cctaacattgtcaagctgctggatgtcatccacacagaaaacaaactgtacctggttttt
gagtttctgcatcaggatctgaagaaatttatggatgcctctgctttgactggcattcct
cttcccctcatcaagagctatctgttccagctgctccagggcctagccttctgccattcg
catcgggttctgcaccgagacctcaaacctcagaatctgcttatcaacgcagagggggcc
atcaagctagcagactttggactagccagagcctttggagtccctgttcgtacttacacc
catgaggtggtgaccctgtggtaccgagcacctgaaatccttctgggctgcaagtactac
tccacagctgtagatatctggagcctgggctgcatctttgctgagatgcacctagtgtgt
acccagcaccatgctaggtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcatcacaaggaggggggatgaccgcagtgtct
accccacaccccgtgacccgccgggccctattccctggagattctgaaatcgaccaactt
ttccggatctttcggactctggggaccccagatgaagtggtttggccaggagttacttct
atgcctgattataagccaagtttccccaagtgggcccggcaagattttagtaaagttgtt
cctcccttggatgaagatggacggagcttgctatcgcaaatgctgcactacgaccccaac
aagcggatttcggcaaaggcagctctggctcaccctttcttccaggatgtgaccaagcca
gtaccccaccttcgactctga

DBGET integrated database retrieval system