KEGG   Undibacterium parvum: EJN92_02010Help
Entry
EJN92_02010       CDS       T05754                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
upv  Undibacterium parvum
Pathway
upv00480  Glutathione metabolism
upv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:upv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EJN92_02010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:upv02000]
    EJN92_02010
Enzymes [BR:upv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EJN92_02010
Transporters [BR:upv02000]
 Other transporters
  Pores ion channels [TC:1]
   EJN92_02010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 Glutaredoxin Tom37
Motif
Other DBs
NCBI-ProteinID: AZP10899
UniProt: A0A3Q9BPL2
LinkDB All DBs
Position
452766..453455
Genome map
AA seq 229 aa AA seqDB search
MSTPSIPLPALTLLSHPLCPYVQRAAILLTEKGIPFERKDIDLANKPKWFLQLSPLGKTP
VLMVGDEAIFESAVICEYLDETQSPRLHPEHPLQRARHRAWMEFGSTILNSIAGFYNALD
EKTLALKVNEIAERFAQIELALGERGGYFSGDDFSIVDAVFGPLFRYFDTFELIDDFHFF
EHTPKVRAWRQQLASRPSIQGAVSDDYQDLLKTFLVDRQSALSKRMETH
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacccctagcatacctctgcccgcattgacattactcagccatcctttgtgccca
tacgtacaacgtgcggcaattttactcaccgaaaaaggaattcctttcgaacgaaaagac
atcgatctggcgaacaagccaaaatggtttttgcagctatcaccgctagggaaaacgcct
gtcttgatggtgggcgatgaggcaatctttgaatccgctgtgatctgtgaatacctcgat
gaaacgcaaagcccacgcctgcatcctgagcatccgctgcaacgtgctcgacaccgggca
tggatggaatttggctctaccatcttgaacagcatagcgggtttctacaatgcactggat
gagaaaacgctcgcattgaaggtcaatgaaatagcagaaagattcgctcaaatagaattg
gcattaggcgagcgaggtggatatttttccggagacgatttttcgatcgtcgatgcagta
ttcgggccactttttcgttatttcgacacgtttgagttgattgatgatttccactttttc
gagcacacgccaaaagtgcgcgcctggcgccaacaattagcatcgcgtccgtcaatccaa
ggcgctgttagtgacgactatcaagatctattaaaaacatttttagtcgatcggcaatcc
gccttatcaaaacgaatggaaacgcattag

DBGET integrated database retrieval system