KEGG   Undibacterium parvum: EJN92_05165Help
Entry
EJN92_05165       CDS       T05754                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K13829  shikimate kinase / 3-dehydroquinate synthase [EC:2.7.1.71 4.2.3.4]
Organism
upv  Undibacterium parvum
Pathway
upv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
upv01100  Metabolic pathways
upv01110  Biosynthesis of secondary metabolites
upv01130  Biosynthesis of antibiotics
upv01230  Biosynthesis of amino acids
Module
upv_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:upv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EJN92_05165
Enzymes [BR:upv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     EJN92_05165
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     EJN92_05165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase SKI Fe-ADH_2 Fe-ADH AAA_18 Cytidylate_kin2 AAA_33 APS_kinase AAA_22 AAA_16 AAA Cytidylate_kin dNK SRP54 TsaE AAA_24 Thymidylate_kin
Motif
Other DBs
NCBI-ProteinID: AZP11440
UniProt: A0A3Q9BPA0
LinkDB All DBs
Position
complement(1221508..1223145)
Genome map
AA seq 545 aa AA seqDB search
MQGSIFLVGLMGSGKTTVGRALAKKLNKRFIDTDHEIEARTGVSIPVIFEVEGEASFRQR
EAEVVKDLTAQDGVVLATGGGAILDEASRRFLHERGTVIYLRAGINSILQRTRHDKNRPL
LRTADPRKKLEELEAQREPLYQQIAHLVIETGRPNVQFLVQSILTQLAFIPGALSSENVL
LMQQQASFQTLRVELGERSYPIAIGASLLASSDVLRQHIKGQRVAVVTNTVVAPLYLAAL
EERLRDLGKQVISIILPDGEEHKTWASLMLIFDALLEAKCDRKITLLALGGGVIGDMTGF
AAASYMRGVPFVQIPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPQAVIADTATLNTL
PDRELSAGLAEVIKHGAIIDAAFFEWIESHILQLRSKDPESLAYAISRSCEIKADVVRQD
EREGGLRAILNFGHTFAHAIESGLGYGKWLHGEAVGCGMVMAADLSCRMGYIDYVSKIRV
QKLVEAAGLPSIAPDLGESRWLELMEVDKKNENGQIKFILLKPLGAPIITGVPKETLLAC
LRASI
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcagcatttttctagtaggtctcatgggctcgggcaaaactacggttggccgg
gctctggcgaaaaaactcaacaaacgctttattgatactgatcatgaaattgaggcccgt
accggggtctcgattcctgtgatttttgaagtcgagggtgaggcgagttttcgccaacgt
gaagcagaagtggttaaagatctgactgcgcaagacggcgtggttttggcaacaggcggc
ggtgctatcctcgatgaggctagtcgccgctttttgcatgagcgcggtaccgttatctac
ttacgtgctggcatcaacagtattttgcagcgcacccgtcacgataaaaatcgaccgctg
ttacgcaccgctgatccgcgcaaaaagctagaagaacttgaagcgcaacgcgaacctctg
tatcagcaaattgcccatttggtgatagagaccggtagacccaatgtacaatttcttgtg
caatccattttgacgcaactggcattcataccgggtgcgctctcttcagaaaacgtttta
ctcatgcagcaacaagcttctttccaaacccttagagtcgaactcggcgaacgcagttat
ccgatcgcgatcggtgcttcattactggcctctagcgatgtattgcgtcagcatatcaag
ggtcagcgggtggcggttgtgactaataccgtggtcgcacctttatatttggctgcgctg
gaagaacgcttgcgtgacttgggtaagcaagtcatcagcattatcttgccggatggcgag
gagcataaaacctgggctagcctgatgttgatttttgatgccttgctggaggctaaatgc
gatagaaaaatcaccttactcgccttaggcggtggggtgatcggtgatatgacgggtttt
gcggcagcctcgtatatgcgcggtgtgcccttcgtgcaaatcccgacgaccttactgtca
caggtggattcttcggtcggtggtaagaccggcatcaatcacccgctcggcaaaaatatg
ataggcgcgttttatcagccgcaggcagtgattgccgacaccgccacgctcaatacctta
cccgatcgtgaattatcagccggcttagctgaagtaatcaaacacggtgcaattatcgat
gccgcgttttttgagtggatagagtcgcatattcttcagttacgcagtaaagacccggag
tctctggcgtatgcgatttcgcgctcttgcgagatcaaagccgatgtggtgcgccaggat
gagcgcgaaggcggtttgcgtgccatactcaattttgggcacacctttgcgcacgcgatt
gaatctggtttgggctatggtaaatggctgcacggtgaagcggtcggttgtggcatggtg
atggcggctgatttatcttgccgtatggggtatatcgattacgtcagtaagatcagagtg
caaaaattggttgaagctgctggtttgcctagcatcgcacctgatttgggtgagagtcgc
tggctggaactgatggaagtcgataagaaaaatgagaatgggcaaatcaagtttatttta
ctcaagcccttaggtgcgccgattattacaggcgtgccaaaagagaccttactcgcttgc
ttgcgagccagtatttag

DBGET integrated database retrieval system