KEGG   Undibacterium parvum: EJN92_09760Help
Entry
EJN92_09760       CDS       T05754                                 

Gene name
gstA
Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
upv  Undibacterium parvum
Pathway
upv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:upv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EJN92_09760 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:upv02000]
    EJN92_09760 (gstA)
Enzymes [BR:upv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EJN92_09760 (gstA)
Transporters [BR:upv02000]
 Other Transporters
  Pores ion channels [TC:1]
   EJN92_09760 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_N_2 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AZP12259
LinkDB All DBs
Position
2244288..2244896
Genome map
AA seq 202 aa AA seqDB search
MKLYYSAGACSLSPHIVLEEAGLKYEAISAPTKTHQLPDGSDYYKINPLGYVPLLVLDDG
RQLREGPAIVQYIADQVPDKHLAPANGTFERSKLQEWLNFIGTEIHKGFSPLFNPATPAD
YKPMVLSRLAERLKFTDGELAGKQYLMGDTFTVADAYLFTVTNWAQFVGLDISGLSNLLA
FRARVAARPAVVAAMTAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatattattctgctggcgcttgttcattgtcaccgcatatcgtcttggaagaa
gcgggtctgaagtatgaggcgatctcggcaccgaccaagacccatcaactgccggacggc
agcgattattacaaaattaatccactaggctatgtgcccttactggtgctggatgacggc
agacaattgcgtgaaggcccggccatcgtccaatacatcgccgaccaggtaccggataaa
catctggcccccgccaacggcacttttgaacgctccaaattacaagagtggttaaacttc
ataggcaccgaaatacataagggtttcagcccgctgtttaaccccgctacaccggctgat
tacaagcctatggtgctgagcagattggccgagcgcttgaagtttaccgatggtgagttg
gcaggtaaacaatatctgatgggcgacacatttacagtggctgacgcgtatctgtttacc
gtgaccaactgggcgcaattcgtcggtctggatatatcgggcttgagcaatttgctggcc
ttccgcgcccgcgtggcagctcgcccggcagtggtagcggcgatgacggcagaaggctta
ttgaagtaa

DBGET integrated database retrieval system