KEGG   Uncinocarpus reesii: UREG_00387Help
Entry
UREG_00387        CDS       T01132                                 

Definition
(RefSeq) prolyl-tRNA synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
ure  Uncinocarpus reesii
Pathway
ure00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ure00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UREG_00387
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ure01007]
    UREG_00387
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ure03016]
    UREG_00387
Enzymes [BR:ure01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     UREG_00387
Amino acid related enzymes [BR:ure01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   UREG_00387
Transfer RNA biogenesis [BR:ure03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    UREG_00387
 Prokaryotic type
    UREG_00387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ProRS-C_1 tRNA-synt_2b HGTP_anticodon DUF1497
Motif
Other DBs
NCBI-GeneID: 8444470
NCBI-ProteinID: XP_002540874
UniProt: C4JL52
LinkDB All DBs
AA seq 586 aa AA seqDB search
MDPAPQGDAIPATGELSKNAAKKAAKQKKQAAEKAEKAANKGIGKSESKTSTAKAPKKKI
EGAALIGIDVAKEDDFAAWYQQPHSFFIWEEIQAWFNDKIKKMGVKNCSFPLFVSEDVLK
KEKDHIEGFAAEVAWVTHAGNNQLEKKIAIRPTSETVMYPYYAKWIRSHRDLPLKLNQWN
SVVRWEFKNPQPFLRTREFLWQEGHTAHLTEAAAREEVLQILQHYAHVYEQLLAVPVIQG
QKTDKEKFAGGLYTTTVEGYIPATGRGIQGGTSHGLGQNFSKMFNITVEDPTSKPDEKKP
PLYVWQNSWGLSTRTLGVMVMVHSDNRGLVLPPRVADIQTVIVPVGLTAKTPDDVRSSIN
AEIEHLRSVLEAAGVRAEVDKREGYSPGWKFNDWELKGIPLRLEFGPGESAGGFVTTSRR
DIPGKEGKSSIPISELATAVPALLETIQADLYARADAEFRAHIKHITRWEDFCPALNDKN
LCMIPHCLTEQCEDEIKEMSARKAEEETGEAIDAKMPSMGAKSLCIPFEQPAGIEKGVTK
CTNPKCSKMAEQWCLFGRKFPFVLTQLLQPWFQQLIEPCCSSPGSY
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgctcctcagggagacgcgatccctgcaacgggtgaactctccaaaaatgct
gcaaagaaggccgcaaaacaaaagaaacaggccgctgagaaggctgaaaaggcagctaat
aaaggcattggcaaatctgagtcaaagacctcgaccgcgaaagcccccaaaaagaagatt
gagggtgccgctcttattggtatagatgtcgcgaaggaagatgattttgctgcatggtac
cagcagcctcattcttttttcatctgggaagagatacaagcgtggtttaatgataaaatt
aagaagatgggtgttaaaaactgttcttttccattattcgtgtccgaagacgtcctgaaa
aaggagaaggatcacatagaaggattcgccgcagaagtcgcctgggttacacatgctgga
aataatcaattagagaaaaagatcgctattcgtccaacttcagaaacggtgatgtaccca
tattatgcgaaatggattcgaagccatcgtgatcttccacttaaactaaaccaatggaac
tcggtggtaagatgggaattcaaaaatcctcaaccattccttcgcactcgtgaattttta
tggcaagaagggcacaccgcgcacttaactgaagcggctgcacgcgaggaggttcttcaa
attcttcagcattacgctcatgtctatgagcagcttcttgcggtcccagtcatccaagga
caaaaaactgataaagagaagtttgctggtggtctttacaccaccactgttgaaggttac
atcccggctactggccgtggtattcagggtggcacgtcccatggactaggtcagaatttt
agcaaaatgttcaacataaccgtcgaagaccctacttcaaaacccgatgaaaagaagccg
ccactttacgtctggcagaactcatggggtttatccactcgtacgcttggtgttatggtg
atggtacatagcgataaccgcggattagtacttcctccgcgagtggctgatattcagacc
gttattgttcctgtcgggcttacggcgaagactcctgacgatgtgcgctcatcgattaac
gctgaaattgagcatttgaggtccgtcttagaggcagctggagtgcgggccgaagtcgac
aaacgcgagggctatagcccaggctggaaattcaacgattgggaactcaaaggtatccct
cttcgtctcgaatttggccccggagagtcagccggcggctttgtaactacgtctcgtcgc
gatattcccgggaaggaagggaaatctagcattccaatctctgagttagctacagccgtc
ccagcccttcttgaaaccatccaggcagacctttacgcccgcgcagacgctgaattccgc
gcccatatcaaacacatcacgaggtgggaagacttctgccctgctcttaatgataaaaat
ctttgcatgatcccgcactgtttgacagaacaatgcgaagacgagattaaagaaatgagt
gctcgaaaagccgaagaagaaacaggcgaagctattgatgccaaaatgccaagcatgggc
gcaaagagtttgtgcatcccattcgaacagccggcaggcattgaaaagggtgttacaaaa
tgtacaaatcccaagtgctcaaagatggcagagcaatggtgcttgtttggacgtaagttt
cccttcgtgttaacacagctcttgcaaccatggtttcagcaactaatcgaaccttgctgc
tcttctccaggctcatactaa

DBGET integrated database retrieval system