KEGG   Uncinocarpus reesii: UREG_00948Help
Entry
UREG_00948        CDS       T01132                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ure  Uncinocarpus reesii
Pathway
ure00010  Glycolysis / Gluconeogenesis
ure00051  Fructose and mannose metabolism
ure00052  Galactose metabolism
ure00500  Starch and sucrose metabolism
ure00520  Amino sugar and nucleotide sugar metabolism
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01130  Biosynthesis of antibiotics
ure01200  Carbon metabolism
Module
ure_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ure_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UREG_00948
   00051 Fructose and mannose metabolism
    UREG_00948
   00052 Galactose metabolism
    UREG_00948
   00500 Starch and sucrose metabolism
    UREG_00948
   00520 Amino sugar and nucleotide sugar metabolism
    UREG_00948
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    UREG_00948
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ure04131]
    UREG_00948
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     UREG_00948
Membrane trafficking [BR:ure04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    UREG_00948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 8441767
NCBI-ProteinID: XP_002541432
UniProt: C4JFD4
LinkDB All DBs
AA seq 532 aa AA seqDB search
MTVTTPRRRPSRKGSMADMPKDLLEQVKELEEIFTVDQACLKKVVNHFVKELEKGNCLLP
LRRFRNSAMLMYHGRTERRGWKHRELPSHLASEISDSTDEHSQLQPMNVTWVMGFPTGHE
QGTFLALDMGGTNLRVCEIFLCEKKGEFDITQSKYRIPEELKNGSASELWEYIADCVQQF
IEYHHEEENLPDLPLGFTFSYPATQDSIDHGVLQRWTKGFDIDGVEGEDVVPMLEQALSK
RGLPIKVAALINDTTGTLIASAYTDPEMKIGCIFGTGVNAAYMENAGSIPKIAHHNLPPD
MPIAINCEYGAFDNERVVLPLTQYDIVIDRDSPRPGQQAFEKMTAGLYLGEIFRLVLLDL
IDNKGNLIFEGQDASSLRKPYCLDSSFLAYIEEDPFENLSETKDLLERTLGLKATKPELE
LCRRLAELIGTRAARLSACGVAAICTKKNIKSCHVGADGSVFNKYPHFKARGAKALREIL
DWADDEEDKVVMSSAEDGSGVGAALIAALTLERVKAGNLAGIRKTDTMKKML
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcactaccccccgtcgaaggccgtcccgtaagggatcaatggccgatatgccg
aaggacctgctcgagcaggtgaaggagcttgaggagatcttcacggtcgaccaggcttgt
ttaaagaaggtcgtcaaccacttcgtcaaggagttggagaagggtaactgtttgctccct
ttacggagatttcgaaattcagctatgctaatgtaccatggaaggactgagcgtcgaggg
tggaaacatcgtgagcttccatcccatcttgcttcggagatatcggacagcactgacgaa
cattctcaactacagcctatgaacgttacctgggtcatgggatttcccaccggccacgaa
caaggcacgttcctcgctcttgacatgggcggcaccaaccttcgtgtttgcgagattttc
ctttgcgaaaagaaaggcgaattcgacatcactcagtctaaataccgcattcccgaagag
ttgaagaacggctctgcaagtgagctttgggaatatattgccgattgcgtccaacaattt
attgaataccaccacgaggaggaaaatttgccggatttgcccctaggtttcaccttctca
tacccagcgactcaagattccattgaccatggtgtgttacaacgatggacaaagggcttt
gatattgacggtgtggagggagaagatgtggtgcctatgctggaacaggctctctcgaag
aggggtcttccgattaaagtcgccgctttgatcaatgataccacaggaaccctcatcgca
tcagcttataccgatccagagatgaaaatcggctgcatctttggaaccggcgttaacgcc
gcctacatggaaaatgccggatcgatcccaaagattgctcaccacaaccttcctcccgac
atgccaattgccattaattgcgaatacggtgcttttgataacgagcgcgtggtgcttccg
ttgacgcaatatgacattgtcatcgaccgcgactcaccccgtcctggccaacaggctttt
gagaagatgactgctggtctttatcttggtgaaatcttccgcctcgttcttctcgacctt
atcgacaacaaaggcaatctcattttcgaaggtcaggatgctagcagcctgcggaagccc
tactgcctggattcatctttcctggcctacatcgaagaagatccctttgaaaacttgtcc
gaaaccaaagaccttctcgagcgtactctcggcctcaaggccaccaagccggaactcgag
ctgtgccgtcgcctcgcagagctcatcggtacccgtgccgcaagactctccgcctgtggt
gttgctgctatctgcacaaaaaagaacatcaaatcctgccacgtcggcgccgatggttca
gtgttcaacaagtatccccatttcaaggctcgtggcgccaaggcactccgtgagatcctc
gactgggcagatgatgaggaggataaggtcgttatgagctctgctgaagacggctctgga
gtgggtgccgcgttgatcgcggcgctgacgctagagagagtcaaggcgggcaatctggcg
ggtattcgaaagactgatacaatgaagaagatgctgtga

DBGET integrated database retrieval system