KEGG   Uncinocarpus reesii: UREG_01769Help
Entry
UREG_01769        CDS       T01132                                 

Definition
(RefSeq) repressible alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ure  Uncinocarpus reesii
Pathway
ure00730  Thiamine metabolism
ure00790  Folate biosynthesis
ure01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    UREG_01769
   00790 Folate biosynthesis
    UREG_01769
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ure04147]
    UREG_01769
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ure00537]
    UREG_01769
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     UREG_01769
Exosome [BR:ure04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UREG_01769
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ure00537]
 Enzymes
  UREG_01769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Ribosomal_S2
Motif
Other DBs
NCBI-GeneID: 8443822
NCBI-ProteinID: XP_002542253
UniProt: C4JJG2
LinkDB All DBs
AA seq 629 aa AA seqDB search
MSRNDPLLVQRPSSDHSPERSDAEEDALLTGERTRRSESRRGATFWREVGLFSWALIATA
AVIVLAVVYQHGQSTGRREGRWAPGEKPEGKRNLVFMVSDGMGPTSLSMTRSFRQFQKDL
PIDDILVLDKHHIGQSRTRSSSSLITDSAAGATAFSCGKKSYNGAISVLPDHSPCGTVLE
AAKAAGYMTGLVVTTRITDATPACFSSHVNMRSYEDLIAEHQVGEYPLGRQVDLILGGGR
CHFLPNSTSGSCRGDDKDIVQLAKSKGFSYIDNRDGFDELKLGSAAQLPLLGLVAEKDIP
FEIDRRFENDVYPSLEEMARTALKALSDATRNSDKGFFIMIEGSRIDHAGHGNDPAAQVH
EVLAYDRAFAAVLEFLENDSTPGVLVSTSDHETGGLAAARQLHESYPDYKWFPGVLANAS
HSSEHLEAKLHDYLDNEGNSASADKKRAYIRREFLEKGLGIFDAQDSEIDRLINPGDQVP
AAYVFADIISRRAQIGWATHGHSAADVNIYASSPHDVLDLVGNHENIEVGQFLAKYLDLD
LGEITRKLRDTETKPHAASERYAWMGEPLADEVVVDELDTYHGDFKKRSLESKPSHEDAE
PRLRLERHSWLTFDSFSQMTDDEFGHHPT
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaaacgaccccttgcttgtccaacgcccttcctccgaccactcaccggaacga
agtgacgccgaagaagatgcccttttaacaggagagcgaactcgtcgcagtgagagtcgc
cggggagcaacattctggcgcgaggttggattgttctcgtgggcattaattgcaaccgct
gcggtcatcgtcttagccgtcgtttaccagcatggacagtcaaccggtaggcgtgaagga
agatgggcgcctggcgagaaacctgaagggaaacgcaacttggtattcatggtatccgat
ggaatgggccccacaagcttatcgatgacacgaagcttccgacaattccagaaagacctt
ccaatcgatgatattcttgtgttggataagcatcacattggacaatcccgaacaagatca
tcctctagcttgattacagactccgcggcgggcgcaacggcgttttcttgcgggaaaaag
agctataatggtgccatttctgtattgccagaccatagcccatgcgggaccgtcctagaa
gccgcaaaggctgctggatatatgacaggcttggtggttacaacaagaattacggatgcc
acccccgcatgcttttcctcccatgtcaatatgcgttcgtatgaggatctaattgccgaa
catcaggttggcgaataccctctgggccgtcaagtcgacctgatccttggaggagggagg
tgtcatttcctacctaattccacgtccggcagctgccgtggtgatgataaggacatcgtg
cagctagcaaaatcgaaaggtttctcttacattgacaatcgtgatgggtttgatgaactc
aagctgggcagtgccgctcagctgccattactaggcctcgttgctgaaaaggacattcca
tttgagattgaccgccgatttgagaatgatgtatacccttccttagaagaaatggctcgc
accgccttgaaagcgttaagtgatgctacacgcaacagtgacaaaggtttcttcatcatg
attgagggctcccgcattgaccatgctggccatggcaacgatcctgctgctcaggtccac
gaagttctagcttatgacagagcctttgccgccgtgctagagtttctggaaaatgattcg
acgcctggtgttcttgtcagcacatcagaccatgaaaccggaggtttagccgcagctcga
cagctccatgagtcttatcctgattataaatggttcccaggcgtccttgccaatgccagc
cattcatccgaacacctagaagccaagctacatgattatcttgacaatgagggaaattcc
gcctctgcggataagaaacgggcctatatccgtcgtgagttccttgaaaaagggctggga
atattcgatgcccaagatagcgagattgaccgacttatcaaccccggggaccaagtacct
gcggcttacgtttttgctgatatcatcagtcgaagagcacagatagggtgggcaacccat
ggtcattccgctgccgacgtgaacatttatgcttcttctccacatgatgtcctggacctt
gttggaaaccacgaaaacatcgaagttggccaattcttggccaagtatctagacttggat
ctaggcgaaattaccagaaaactccgagatacggagactaagccgcatgccgccagcgaa
agatacgcttggatgggtgaaccgctcgccgatgaagttgtcgtcgacgaacttgatact
tatcacggtgactttaagaagcgtagtcttgaatccaaaccctcccatgaagacgccgaa
ccccgcctcagactggaaaggcactcatggctgacgttcgatagcttcagccagatgaca
gatgacgaattcggccaccaccccacatag

DBGET integrated database retrieval system