KEGG   Uncinocarpus reesii: UREG_02869Help
Entry
UREG_02869        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K21292  ent-kaurene oxidase [EC:1.14.14.86]
Organism
ure  Uncinocarpus reesii
Pathway
ure00904  Diterpenoid biosynthesis
ure01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    UREG_02869
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ure00199]
    UREG_02869
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     UREG_02869
Cytochrome P450 [BR:ure00199]
 Cytochrome P450, fungi type
  CYP503 family
   UREG_02869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 8443482
NCBI-ProteinID: XP_002543353
UniProt: C4JIC3
LinkDB All DBs
AA seq 524 aa AA seqDB search
MPLFENTLLRNMQSTLNDTWLKLSCQKPAVFVFGVTVFLSWQLVNRIFFSVKAPYAGYES
SWEPIWLISRRCSHEAPRLIQEGYRRYRDAMFKIAKRNSDLLVIPKKFVEELRSLPEEQI
CAMEAHIRTLLGPITGTDILLNGHLHNKALQTRLTPNLGSLVQPLKDELDYAISVELPNC
KDEWVEVQMHGIVRRLVARLSARAFTGPVACRDEDWVMTNTMYPANVFTTIGPLRLFPSF
MRSTVALFLPSYWQLRSNFATANRVLVPIILQRRRDEASGDLNYEKPKDLLQWLMDLAEP
NEAAPHLLAHRQLALSLGSLNTTTTAAVQTLYDICDHPEYLESLRTEVLGALTADGGWDR
TTITKLVGLDSFMKESQRVNPPSYVSFNRVVRKSLTLSDGTRLPKGTHFGMASYSILQDP
AIIENPHEFDGFRYKRIREDPKEANKHQFASTDSNNIHFGHGKYACPGRFFASQIVKMII
GHLILKFDFKFPEGQGRPRNLSIDENVYPDPSARLMMRRRQMVY
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgtttgagaatacccttttgagaaatatgcagtccacgttgaacgatacctgg
ctgaaactttcgtgtcaaaagcctgctgtttttgtctttggtgttactgtctttctttca
tggcaattagtgaacaggatcttttttagcgtcaaggccccgtatgccggctatgaatca
tcgtgggagccgatatggctgataagccgtcgatgctcacatgaagcccctcgacttata
caggaaggataccgtcgatatcgagatgcaatgttcaaaattgcaaaacgcaactccgac
cttttggtgattcctaagaagtttgttgaggagttgaggagccttcctgaagagcaaata
tgtgccatggaagctcacattcggacccttctcgggcccattacagggacagatatctta
ctcaacggacatctccataacaaagccttacaaacaaggttgacccccaatcttggatct
ctcgtccagccgttgaaagatgagcttgactatgccatcagcgtggagcttcctaactgc
aaagacgagtgggttgaagtacagatgcacggcatagtacgccgactcgtagcaagactc
tccgcccgtgctttcactggaccagttgcctgcagggatgaagattgggtaatgaccaat
actatgtatccggcgaatgtttttacaaccattgggcccttgcgtctgttcccgtccttt
atgcgctcgaccgttgcgttgttcttgccttcttactggcagcttcgctccaatttcgcc
acggcaaaccgcgtattggttcccattatcctgcaaagacgtcgcgatgaggcctccggg
gacttaaattacgagaaacccaaggacctgctccaatggttaatggaccttgccgagccg
aatgaagccgcaccacacttgcttgctcatcgccaattggcattgagtctcgggtcgctg
aatacaacaaccacggccgctgtgcaaactctgtacgacatttgcgaccatcccgaatat
cttgaaagcctgcggacggaggttctcggtgctctgacggctgacggtggatgggacagg
acgacaatcaccaagctggttggtcttgatagcttcatgaaagaatcgcaacgagttaac
ccgcctagttacgtgtccttcaatcgagttgtccgcaagtctcttaccctctctgacggg
acacgactcccaaagggaacacatttcggtatggcttcgtattcaatactccaagaccct
gccatcattgagaatccacatgagttcgatggtttccggtacaagagaattcgcgaagac
cccaaggaagccaacaaacatcaattcgcctccacggactcgaacaacatccatttcggc
catggcaagtacgcctgcccaggccgatttttcgcatcccaaatcgttaaaatgatcatt
ggccatttgatcttgaagtttgatttcaaatttcctgagggccagggtcgcccgcgcaac
ttgagcattgatgagaacgtgtacccggatccatctgcaaggctaatgatgcgacgacgt
caaatggtttattag

DBGET integrated database retrieval system