KEGG   Uncinocarpus reesii: UREG_03256Help
Entry
UREG_03256        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ure  Uncinocarpus reesii
Pathway
ure00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UREG_03256
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ure02000]
    UREG_03256
Enzymes [BR:ure01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     UREG_03256
Transporters [BR:ure02000]
 Other Transporters
  Pores ion channels [TC:1]
   UREG_03256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_5 GST_C_2
Motif
Other DBs
NCBI-GeneID: 8442738
NCBI-ProteinID: XP_002543739
UniProt: C4JQ23
LinkDB All DBs
AA seq 257 aa AA seqDB search
MASTYPAHLHHAATGSAKKLADEHSGEQPLKLYAGWFFQRTWIVLEEKKIPYQYIEVNPY
DKPASLLSLNPRGLVPTLHCPQPGGQAAKPLYESNIINEYLDDAYPDHTPRFLPSDPYER
ARAKIWIDFASSKIVPGFHRFLRCQDEEGISKARAEFLGYLKEFTLAMDDEGPYFLGKGF
MMPDVVLAPWAMRLWSFEQFKGGLGIPDPGQGGPDEEVWQRWRRWLAAVTGRRSVQDVMS
DREHYLPIYKRFADNLA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcatctacttatcctgcacacctccatcatgccgcaaccggttctgcaaagaagctg
gcggatgagcattcaggggaacagccgttaaagctttatgctggatggttcttccagcga
acatggatagtccttgaggagaaaaaaatcccgtaccagtacatcgaagtcaatccatac
gacaaaccggcttcgctcttatccctcaacccgcgaggcctggtccctacgctacactgc
ccgcaaccaggtgggcaggctgccaaacctctctacgaatcaaacattatcaacgagtac
ctcgacgatgcttatccagaccataccccacggtttttaccctcagatccatatgaacgg
gctagagcgaaaatctggattgattttgcctcgtcaaaaatcgtgcctggcttccatcgt
tttttgcgatgccaagacgaagagggaattagtaaagctcgtgcggagttcctgggttat
ttgaaagaattcacactcgcgatggatgacgaaggaccgtatttcttgggtaagggattc
atgatgcctgatgtggtgcttgctccatgggcgatgagattatggtctttcgaacagttc
aaaggcgggttgggaatcccagaccctggtcagggaggtcccgacgaggaggtctggcaa
agatggaggaggtggttggctgcggtgacgggtagaagatccgtgcaggatgtcatgagt
gacagggagcactacctaccgatttacaaacggtttgcggataatcttgcgtag

DBGET integrated database retrieval system