KEGG   Uncinocarpus reesii: UREG_03372Help
Entry
UREG_03372        CDS       T01132                                 

Definition
(RefSeq) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ure  Uncinocarpus reesii
Brite
Translation factors [BR:ure03012]
 Eukaryotic Type
  Elongation factors
   UREG_03372
 Prokaryotic Type
   UREG_03372
Mitochondrial biogenesis [BR:ure03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    UREG_03372
Exosome [BR:ure04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UREG_03372
  Exosomal proteins of breast cancer cells
   UREG_03372
  Exosomal proteins of colorectal cancer cells
   UREG_03372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase DUF763
Motif
Other DBs
NCBI-GeneID: 8440211
NCBI-ProteinID: XP_002543855
UniProt: C4JQM7
LinkDB All DBs
AA seq 444 aa AA seqDB search
MSNISRSLNVLLRTSRLSLQRPRAVNPVQHVFARDRFAARGMATAFERTKPHVNIANFPK
GTIGHVDHGKTTLTAAITKRQSEKGMANFLEYGAIDKAPEERKRGITISSAHIEYQTENR
HYAHVDCPGHADYIKNMITGAASMDGAVVVVAASDGQMPQTREHLLLARQIGIQKIVVFV
NKVDAVEDPEMLELVELEMRELLTSYGFEGEETPIVFGSALCALEGRRPEIGNSKIDELL
QAVDTWIPTPQRDTDKPFLMSIEEVFSISGRGTVVSGRVERGILKKDSEVEIVGGNAEPI
KTKVTDIETFKKSCDESRAGDNSGLLLRGVKREDINRGMVVAVPGSVKAHTEFLVSLYVL
TEAEGGRRHGFTNKYRPQMFIRTADEAAQLSWPGEDQDRTAMPGDNVEMVCTTLHPVPAE
AGQRFNIREGGRTVATGLVTRVIK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacatctctagatctctcaacgtcctgctgaggaccagcagactttccctacaa
agacctagagccgtcaatcccgtccagcatgtctttgctcgggatcgattcgcagctcgg
ggcatggctacggccttcgagagaaccaagccccatgttaacatcgctaattttccaaaa
ggcaccattggccacgttgatcacggaaagacaaccttgacagcagccatcaccaagcgt
caatcggagaagggcatggccaacttcttagaatacggtgcaattgacaaggctcctgag
gagagaaagcgtggtatcaccatttcctccgcacacattgaataccagaccgaaaaccga
cactacgcccacgtcgactgccctgggcacgctgattatatcaagaacatgattactggt
gctgctagcatggatggcgcagtcgttgtcgttgctgcttcagatggacaaatgcctcaa
actcgagaacatttacttctggcgcgtcaaatcggtattcaaaaaatcgtcgttttcgtg
aacaaggtcgatgcggtcgaagacccggagatgttggaacttgtcgaactagaaatgcgt
gagctcctcaccagctacggctttgagggtgaagaaacccccattgtcttcggctctgct
ctctgtgccctggaaggacgacgacctgaaatcggtaacagcaaaatcgatgagctcctg
caagctgttgacacctggatccccactccccagcgtgacactgacaagcctttcctgatg
tctatcgaagaagtcttttccatttctggaagaggaacagtcgtttccggccgtgttgag
cgcggtatcttgaagaaggactctgaagtcgaaattgttggcggtaatgcggagccaatc
aagaccaaggtcactgatatcgaaaccttcaagaagtcctgtgacgaatcccgcgccgga
gataactctggtttgcttctccggggtgttaagcgtgaagacatcaaccgtggcatggtt
gttgccgtgcccgggagtgtcaaagcccacactgagttcttagtctccctttatgttctt
accgaagccgaaggtggtcgtagacacggtttcaccaacaaataccgcccacagatgttc
atccgcactgctgatgaggctgctcaactcagctggcctggcgaagatcaggacaggacc
gctatgccaggagacaacgtcgagatggtctgcacgactttacacccggttcccgccgag
gccggtcaacgattcaacatccgtgagggtggaagaaccgtcgcaaccgggcttgtcacc
cgtgtcatcaaatag

DBGET integrated database retrieval system